Western Blot (WB)
(WB Suggested Anti-TEX14 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Muscle)
Rabbit TEX14 Polyclonal Antibody | anti-TEX14 antibody
TEX14 antibody - C-terminal region
Gene Names
TEX14; CT113; SPGF23
Reactivity
Horse, Human, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TEX14; Polyclonal Antibody; TEX14 antibody - C-terminal region; anti-TEX14 antibody
Host
Rabbit
Reactivity
Horse, Human, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ASSDTLVAVEKSYSTSSPIEEDFEGIQGAFAQPQVSGEEKFQMRKILGKN
Sequence Length
1451
Applicable Applications for anti-TEX14 antibody
Western Blot (WB)
Homology
Horse: 86%; Human: 100%; Rabbit: 86%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human TEX14
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-TEX14 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Muscle)
Western Blot (WB)
(WB Suggested Anti-TEX14 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Muscle)
Related Product Information for anti-TEX14 antibody
This is a rabbit polyclonal antibody against TEX14. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: TEX14 belongs to the protein kinase superfamily. It contains 3 ANK repeats and 1 protein kinase domain. TEX14 is required for spermatogenesis and male fertility. It may be required for normal structure of the intercellular bridge that connects spermatocytes and spermatogonia. It has no protein kinase activity. This gene is similar to a mouse gene that is expressed in the testis.
Target Description: TEX14 belongs to the protein kinase superfamily. It contains 3 ANK repeats and 1 protein kinase domain. TEX14 is required for spermatogenesis and male fertility. It may be required for normal structure of the intercellular bridge that connects spermatocytes and spermatogonia. It has no protein kinase activity. This gene is similar to a mouse gene that is expressed in the testis.
Product Categories/Family for anti-TEX14 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
160kDa
NCBI Official Full Name
inactive serine/threonine-protein kinase TEX14 isoform b
NCBI Official Synonym Full Names
testis expressed 14, intercellular bridge forming factor
NCBI Official Symbol
TEX14
NCBI Official Synonym Symbols
CT113; SPGF23
NCBI Protein Information
inactive serine/threonine-protein kinase TEX14
UniProt Protein Name
Inactive serine/threonine-protein kinase TEX14
Protein Family
UniProt Gene Name
TEX14
UniProt Synonym Gene Names
SGK307
UniProt Entry Name
TEX14_HUMAN
NCBI Description
The protein encoded by this gene is necessary for intercellular bridges in germ cells, which are required for spermatogenesis. Three transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jan 2011]
Research Articles on TEX14
Similar Products
Product Notes
The TEX14 tex14 (Catalog #AAA3211553) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TEX14 antibody - C-terminal region reacts with Horse, Human, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TEX14 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TEX14 tex14 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ASSDTLVAVE KSYSTSSPIE EDFEGIQGAF AQPQVSGEEK FQMRKILGKN. It is sometimes possible for the material contained within the vial of "TEX14, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
