Western Blot (WB)
(Host: RabbitTarget Name: TESCSample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/mlTESC is supported by BioGPS gene expression data to be expressed in Jurkat)
Rabbit TESC Polyclonal Antibody | anti-TESC antibody
TESC Antibody - C-terminal region
Gene Names
TESC; TSC; CHP3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TESC; Polyclonal Antibody; TESC Antibody - C-terminal region; anti-TESC antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DSDGRITLEEYRNVVEELLSGNPHIEKESARSIADGAMMEAASVCMGQME
Sequence Length
214
Applicable Applications for anti-TESC antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human TESC
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: TESCSample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/mlTESC is supported by BioGPS gene expression data to be expressed in Jurkat)
Western Blot (WB)
(Host: RabbitTarget Name: TESCSample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/mlTESC is supported by BioGPS gene expression data to be expressed in Jurkat)
Related Product Information for anti-TESC antibody
This is a rabbit polyclonal antibody against TESC. It was validated on Western Blot
Target Description: TESC functions as an integral cofactor in cell pH regulation by controlling plasma membrane-type Na+/H+Â exchange activity. It promotes the maturation, transport, cell surface stability and exchange activity of SLC9A1/NHE1 at the plasma membrane and promotes the induction of hematopoietic stem cell differentiation toward megakaryocytic lineage. It is essential for the coupling of ERK cascade activation with the expression of ETS family genes in megakaryocytic differentiation. It is also involved in granulocytic differentiation in a ERK-dependent manner and inhibits the phosphatase activity of calcineurin.
Target Description: TESC functions as an integral cofactor in cell pH regulation by controlling plasma membrane-type Na+/H+Â exchange activity. It promotes the maturation, transport, cell surface stability and exchange activity of SLC9A1/NHE1 at the plasma membrane and promotes the induction of hematopoietic stem cell differentiation toward megakaryocytic lineage. It is essential for the coupling of ERK cascade activation with the expression of ETS family genes in megakaryocytic differentiation. It is also involved in granulocytic differentiation in a ERK-dependent manner and inhibits the phosphatase activity of calcineurin.
Product Categories/Family for anti-TESC antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
calcineurin B homologous protein 3 isoform 1
NCBI Official Synonym Full Names
tescalcin
NCBI Official Symbol
TESC
NCBI Official Synonym Symbols
TSC; CHP3
NCBI Protein Information
calcineurin B homologous protein 3
UniProt Protein Name
Calcineurin B homologous protein 3
Protein Family
UniProt Gene Name
TESC
UniProt Synonym Gene Names
CHP3; TSC
UniProt Entry Name
CHP3_HUMAN
Research Articles on TESC
Similar Products
Product Notes
The TESC tesc (Catalog #AAA3213153) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TESC Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's TESC can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TESC tesc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DSDGRITLEE YRNVVEELLS GNPHIEKESA RSIADGAMME AASVCMGQME. It is sometimes possible for the material contained within the vial of "TESC, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
