Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Rabbit TENT2 Polyclonal Antibody | anti-TENT2 antibody

TENT2 Antibody - C-terminal region

Gene Names
Tent2; Papd4
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TENT2; Polyclonal Antibody; TENT2 Antibody - C-terminal region; anti-TENT2 antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YICVEEPFDGTNTARAVHEKQKFDMIKDQFLKSWQRLKNKRDLNSVLPLR
Sequence Length
484
Applicable Applications for anti-TENT2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 83%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Rat
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Papd4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Rat Kidney)

Related Product Information for anti-TENT2 antibody
This is a rabbit polyclonal antibody against Papd4 . It was validated on Western Blot
Product Categories/Family for anti-TENT2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
poly(A) RNA polymerase GLD2
NCBI Official Synonym Full Names
terminal nucleotidyltransferase 2
NCBI Official Symbol
Tent2
NCBI Official Synonym Symbols
Papd4
NCBI Protein Information
poly(A) RNA polymerase GLD2
UniProt Protein Name
Poly(A) RNA polymerase GLD2
UniProt Gene Name
Papd4
UniProt Entry Name
GLD2_RAT

Research Articles on TENT2

Similar Products

Product Notes

The TENT2 papd4 (Catalog #AAA3209331) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TENT2 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's TENT2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TENT2 papd4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YICVEEPFDG TNTARAVHEK QKFDMIKDQF LKSWQRLKNK RDLNSVLPLR. It is sometimes possible for the material contained within the vial of "TENT2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual