Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TCL1A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human brain)

Rabbit anti-Human TCL1A Polyclonal Antibody | anti-TCL1A antibody

TCL1A antibody - N-terminal region

Gene Names
TCL1A; TCL1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TCL1A; Polyclonal Antibody; TCL1A antibody - N-terminal region; anti-TCL1A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVL
Sequence Length
114
Applicable Applications for anti-TCL1A antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TCL1A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TCL1A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human brain)

Western Blot (WB) (WB Suggested Anti-TCL1A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human brain)
Related Product Information for anti-TCL1A antibody
This is a rabbit polyclonal antibody against TCL1A. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TCL1A can enhance the phosphorylation and activation of AKT1, AKT2 and AKT3;promote nuclear translocation of AKT1;enhance cell proliferation, stabilize mitochondrial membrane potential and promote cell survival.
Product Categories/Family for anti-TCL1A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13kDa
NCBI Official Full Name
T-cell leukemia/lymphoma protein 1A
NCBI Official Synonym Full Names
T cell leukemia/lymphoma 1A
NCBI Official Symbol
TCL1A
NCBI Official Synonym Symbols
TCL1
NCBI Protein Information
T-cell leukemia/lymphoma protein 1A
UniProt Protein Name
T-cell leukemia/lymphoma protein 1A
UniProt Gene Name
TCL1A
UniProt Synonym Gene Names
TCL1; Oncogene TCL1
UniProt Entry Name
TCL1A_HUMAN

NCBI Description

Overexpression of the TCL1 gene in humans has been implicated in the development of mature T cell leukemia, in which chromosomal rearrangements bring the TCL1 gene in close proximity to the T-cell antigen receptor (TCR)-alpha (MIM 186880) or TCR-beta (MIM 186930) regulatory elements (summarized by Virgilio et al., 1998 [PubMed 9520462]). In normal T cells TCL1 is expressed in CD4-/CD8- cells, but not in cells at later stages of differentiation. TCL1 functions as a coactivator of the cell survival kinase AKT (MIM 164730) (Laine et al., 2000 [PubMed 10983986]).[supplied by OMIM, Jul 2010]

Uniprot Description

TCL1A: Enhances the phosphorylation and activation of AKT1, AKT2 and AKT3. Promotes nuclear translocation of AKT1. Enhances cell proliferation, stabilizes mitochondrial membrane potential and promotes cell survival. Homodimer. Interacts with AKT1, AKT2 and AKT3 (via PH domain). Interacts with PNPT1; the interaction has no effect on PNPT1 exonuclease activity. Restricted in the T-cell lineage to immature thymocytes and activated peripheral lymphocytes. Preferentially expressed early in T- and B-lymphocyte differentiation. Belongs to the TCL1 family.

Protein type: Oncoprotein; Protein kinase, regulatory subunit

Chromosomal Location of Human Ortholog: 14q32.1

Cellular Component: endoplasmic reticulum; pronucleus; cell cortex

Molecular Function: protein binding

Biological Process: multicellular organismal development; stem cell maintenance

Research Articles on TCL1A

Similar Products

Product Notes

The TCL1A tcl1a (Catalog #AAA3214061) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TCL1A antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TCL1A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TCL1A tcl1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MAECPTLGEA VTDHPDRLWA WEKFVYLDEK QHAWLPLTIE IKDRLQLRVL. It is sometimes possible for the material contained within the vial of "TCL1A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.