Western Blot (WB)
(WB Suggested Anti-TBCD AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole Cell)
Rabbit anti-Human TBCD Polyclonal Antibody | anti-TBCD antibody
TBCD antibody - N-terminal region
Gene Names
TBCD; tfcD; PEBAT; SSD-1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TBCD; Polyclonal Antibody; TBCD antibody - N-terminal region; anti-TBCD antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KLVQRLGLTFLKPKVAAWRYQRGCRSLAANLQLLTQGQSEQKPLILTEDD
Sequence Length
1192
Applicable Applications for anti-TBCD antibody
Western Blot (WB)
Homology
Human: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-TBCD AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole Cell)
Western Blot (WB)
(WB Suggested Anti-TBCD AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole Cell)
Related Product Information for anti-TBCD antibody
This is a rabbit polyclonal antibody against TBCD. It was validated on Western Blot
Target Description: Cofactor D is one of four proteins (cofactors A, D, E, and C) involved in the pathway leading to correctly folded beta-tubulin from folding intermediates. Cofactors A and D are believed to play a role in capturing and stabilizing beta-tubulin intermediates in a quasi-native confirmation. Cofactor E binds to the cofactor D/beta-tubulin complex; interaction with cofactor C then causes the release of beta-tubulin polypeptides that are committed to the native state.
Target Description: Cofactor D is one of four proteins (cofactors A, D, E, and C) involved in the pathway leading to correctly folded beta-tubulin from folding intermediates. Cofactors A and D are believed to play a role in capturing and stabilizing beta-tubulin intermediates in a quasi-native confirmation. Cofactor E binds to the cofactor D/beta-tubulin complex; interaction with cofactor C then causes the release of beta-tubulin polypeptides that are committed to the native state.
Product Categories/Family for anti-TBCD antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
131kDa
NCBI Official Full Name
tubulin-specific chaperone D
NCBI Official Synonym Full Names
tubulin folding cofactor D
NCBI Official Symbol
TBCD
NCBI Official Synonym Symbols
tfcD; PEBAT; SSD-1
NCBI Protein Information
tubulin-specific chaperone D
UniProt Protein Name
Tubulin-specific chaperone D
Protein Family
UniProt Gene Name
TBCD
UniProt Synonym Gene Names
KIAA0988; SSD1; TFCD; tfcD
UniProt Entry Name
TBCD_HUMAN
NCBI Description
Cofactor D is one of four proteins (cofactors A, D, E, and C) involved in the pathway leading to correctly folded beta-tubulin from folding intermediates. Cofactors A and D are believed to play a role in capturing and stabilizing beta-tubulin intermediates in a quasi-native confirmation. Cofactor E binds to the cofactor D/beta-tubulin complex; interaction with cofactor C then causes the release of beta-tubulin polypeptides that are committed to the native state. [provided by RefSeq, Jul 2008]
Research Articles on TBCD
Similar Products
Product Notes
The TBCD tbcd (Catalog #AAA3215397) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TBCD antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TBCD can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TBCD tbcd for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KLVQRLGLTF LKPKVAAWRY QRGCRSLAAN LQLLTQGQSE QKPLILTEDD. It is sometimes possible for the material contained within the vial of "TBCD, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
