Western Blot (WB)
(Host: RabbitTarget Name: TAF1DSample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Human TAF1D Polyclonal Antibody | anti-TAF1D antibody
TAF1D Antibody - middle region
Gene Names
TAF1D; JOSD3; RAFI41; TAFI41; TAF(I)41
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
TAF1D; Polyclonal Antibody; TAF1D Antibody - middle region; anti-TAF1D antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FEQAVARGFFNYIEKLKYEHHLKESLKQMNVGEDLENEDFDSRRYKFLDD
Sequence Length
278
Applicable Applications for anti-TAF1D antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TAF1D
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: TAF1DSample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: TAF1DSample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-TAF1D antibody
TAF1D is a member of the SL1 complex, which includes TBP (MIM 600075) and TAF1A (MIM 604903), TAF1B (MIM 604904), and TAF1C (MIM 604905), and plays a role in RNA polymerase I transcription (Wang et al., 2004 [PubMed 15520167]; Gorski et al., 2007 [PubMed 17318177]).[supplied by OMIM, Jun 2009]
Product Categories/Family for anti-TAF1D antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31 kDa
NCBI Official Full Name
TATA box-binding protein-associated factor RNA polymerase I subunit D
NCBI Official Synonym Full Names
TATA-box binding protein associated factor, RNA polymerase I subunit D
NCBI Official Symbol
TAF1D
NCBI Official Synonym Symbols
JOSD3; RAFI41; TAFI41; TAF(I)41
NCBI Protein Information
TATA box-binding protein-associated factor RNA polymerase I subunit D
UniProt Protein Name
TATA box-binding protein-associated factor RNA polymerase I subunit D
Protein Family
UniProt Gene Name
TAF1D
UniProt Synonym Gene Names
JOSD3; TAFI41; TBP-associated factor 1D
UniProt Entry Name
TAF1D_HUMAN
NCBI Description
TAF1D is a member of the SL1 complex, which includes TBP (MIM 600075) and TAF1A (MIM 604903), TAF1B (MIM 604904), and TAF1C (MIM 604905), and plays a role in RNA polymerase I transcription (Wang et al., 2004 [PubMed 15520167]; Gorski et al., 2007 [PubMed 17318177]).[supplied by OMIM, Jun 2009]
Research Articles on TAF1D
Similar Products
Product Notes
The TAF1D taf1d (Catalog #AAA3221253) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TAF1D Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TAF1D can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TAF1D taf1d for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FEQAVARGFF NYIEKLKYEH HLKESLKQMN VGEDLENEDF DSRRYKFLDD. It is sometimes possible for the material contained within the vial of "TAF1D, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
