Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: NK2RSample Type: 786-0 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human TACR2 Polyclonal Antibody | anti-TACR2 antibody

TACR2 Antibody - C-terminal region

Gene Names
TACR2; SKR; NK2R; NKNAR; TAC2R
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TACR2; Polyclonal Antibody; TACR2 Antibody - C-terminal region; anti-TACR2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ELTPTTSLSTRVNRCHTKETLFMAGDTAPSEATSGEAGRPQDGSGLWFGY
Sequence Length
398
Applicable Applications for anti-TACR2 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human NK2R
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: NK2RSample Type: 786-0 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: NK2RSample Type: 786-0 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-TACR2 antibody
This is a rabbit polyclonal antibody against NK2R. It was validated on Western Blot

Target Description: This gene belongs to a family of genes that function as receptors for tachykinins. Receptor affinities are specified by variations in the 5'-end of the sequence. The receptors belonging to this family are characterized by interactions with G proteins and 7 hydrophobic transmembrane regions. This gene encodes the receptor for the tachykinin neuropeptide substance K, also referred to as neurokinin A.
Product Categories/Family for anti-TACR2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
substance-K receptor
NCBI Official Synonym Full Names
tachykinin receptor 2
NCBI Official Symbol
TACR2
NCBI Official Synonym Symbols
SKR; NK2R; NKNAR; TAC2R
NCBI Protein Information
substance-K receptor
UniProt Protein Name
Substance-K receptor
Protein Family
UniProt Gene Name
TACR2
UniProt Synonym Gene Names
NK2R; NKNAR; TAC2R; SKR; NK-2R
UniProt Entry Name
NK2R_HUMAN

NCBI Description

This gene belongs to a family of genes that function as receptors for tachykinins. Receptor affinities are specified by variations in the 5'-end of the sequence. The receptors belonging to this family are characterized by interactions with G proteins and 7 hydrophobic transmembrane regions. This gene encodes the receptor for the tachykinin neuropeptide substance K, also referred to as neurokinin A. [provided by RefSeq, Jul 2008]

Uniprot Description

TACR2: This is a receptor for the tachykinin neuropeptide substance K (neurokinin A). It is associated with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of affinity of this receptor to tachykinins is: substance K > neuromedin-K > substance P. Belongs to the G-protein coupled receptor 1 family.

Protein type: GPCR, family 1; Receptor, GPCR; Membrane protein, integral; Membrane protein, multi-pass; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 10q22.1

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: substance K receptor activity; protein binding; tachykinin receptor activity

Biological Process: negative regulation of luteinizing hormone secretion; tachykinin signaling pathway; muscle contraction; intestine smooth muscle contraction; operant conditioning; response to electrical stimulus; excretion; positive regulation of vascular permeability; positive regulation of acetylcholine secretion

Research Articles on TACR2

Similar Products

Product Notes

The TACR2 tacr2 (Catalog #AAA3217008) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TACR2 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TACR2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TACR2 tacr2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ELTPTTSLST RVNRCHTKET LFMAGDTAPS EATSGEAGRP QDGSGLWFGY. It is sometimes possible for the material contained within the vial of "TACR2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.