SDS-Page
Complement factor D (Cfd) Recombinant Protein | Cfd recombinant protein
Recombinant Rat Complement factor D (Cfd)
Gene Names
Cfd; Df; Adn; EVE
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Complement factor D (Cfd); Recombinant Rat Complement factor D (Cfd); Complement factor D; EC=3.4.21.46; Adipsin; C3 convertase activator; Endogenous vascular elastase; Properdin factor D; Cfd recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
26-263aa; Full Length of Mature Protein
Sequence
ILGGQEAMAHARPYMASVQVNGTHVCGGTLVDEQWVLSAAHCMDGVTKDEVVQVLLGAHSLSSPEPYKHLYDVQSVVLHPGSRPDSVEDDLMLFKLSHNASLGPHVRPLPLQREDREVKPGTLCDVAGWGVVTHAGRRPDVLQQLTVSIMDRNTCNLRTYHDGAITKNMMCAESNRRDTCRGDSGGPLVCGDAVEAVVTWGSRVCGNRRKPGVFTRVATYVPWIENVLSGNVSVNVTA
Sequence Length
238
Species
Rattus norvegicus (Rat)
Production Note
Special Offer: The Mammalian-Cell, Yeast host-expressed protein is manufactured from a stock plasmid containing the protein gene. Mammalian-Cell, Yeasthost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The Mammalian-Cell, Yeast host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select Mammalian-Cell, Yeast host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-Page
SDS-Page
Related Product Information for Cfd recombinant protein
Factor D cleaves factor B when the latter is complexed with factor C3b, activating the C3bbb complex, which then becomes the C3 convertase of the alternate pathway. Its function is homologous to that of C1s in the classical pathway.
Product Categories/Family for Cfd recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27.8 kDa
NCBI Official Full Name
complement factor D
NCBI Official Synonym Full Names
complement factor D (adipsin)
NCBI Official Symbol
Cfd
NCBI Official Synonym Symbols
Df; Adn; EVE
NCBI Protein Information
complement factor D; adipsin; properdin factor D; C3 convertase activator; endogenous vascular elastase; D component of complement (adipsin)
UniProt Protein Name
Complement factor D
Protein Family
UniProt Gene Name
Cfd
UniProt Synonym Gene Names
Adn; Df
UniProt Entry Name
CFAD_RAT
NCBI Description
serine protease adipocyte-specific protein mediated by the Notch/Hes-1 signaling pathway; can be used as a fecal biomarker for abnormal intestinal epithelial differentiation [RGD, Feb 2006]
Uniprot Description
Factor D cleaves factor B when the latter is complexed with factor C3b, activating the C3bbb complex, which then becomes the C3 convertase of the alternate pathway. Its function is homologous to that of C1s in the classical pathway.
Research Articles on Cfd
Similar Products
Product Notes
The Cfd cfd (Catalog #AAA949911) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 26-263aa; Full Length of Mature Protein. The amino acid sequence is listed below: ILGGQEAMAH ARPYMASVQV NGTHVCGGTL VDEQWVLSAA HCMDGVTKDE VVQVLLGAHS LSSPEPYKHL YDVQSVVLHP GSRPDSVEDD LMLFKLSHNA SLGPHVRPLP LQREDREVKP GTLCDVAGWG VVTHAGRRPD VLQQLTVSIM DRNTCNLRTY HDGAITKNMM CAESNRRDTC RGDSGGPLVC GDAVEAVVTW GSRVCGNRRK PGVFTRVATY VPWIENVLSG NVSVNVTA. It is sometimes possible for the material contained within the vial of "Complement factor D (Cfd), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
