Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Sample Type: Mouse retinaSample Type: complete mouse retina sectionsRed: PrimaryBlue: DAPIPrimaryDilution: 1:200Secondary Antibody: Goat anti-Rabbit AF568 IgG(H+L)SecondaryDilution: 1:200Image Submitted by: David ZenisekYale University )

Rabbit SYT5 Polyclonal Antibody | anti-SYT5 antibody

SYT5 antibody - middle region

Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
SYT5; Polyclonal Antibody; SYT5 antibody - middle region; anti-SYT5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YLLPDKRRRYETKVHRQTLNPHFGETFAFKVPYVELGGRVLVMAVYDFDR
Sequence Length
386
Applicable Applications for anti-SYT5 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 93%; Mouse: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SYT5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Sample Type: Mouse retinaSample Type: complete mouse retina sectionsRed: PrimaryBlue: DAPIPrimaryDilution: 1:200Secondary Antibody: Goat anti-Rabbit AF568 IgG(H+L)SecondaryDilution: 1:200Image Submitted by: David ZenisekYale University )

Immunohistochemistry (IHC) (Sample Type: Mouse retinaSample Type: complete mouse retina sectionsRed: PrimaryBlue: DAPIPrimaryDilution: 1:200Secondary Antibody: Goat anti-Rabbit AF568 IgG(H+L)SecondaryDilution: 1:200Image Submitted by: David ZenisekYale University )

Western Blot (WB)

(WB Suggested Anti-SYT5 Antibody Titration: 1 ug/mlPositive Control: Fetal kidney lysate)

Western Blot (WB) (WB Suggested Anti-SYT5 Antibody Titration: 1 ug/mlPositive Control: Fetal kidney lysate)
Related Product Information for anti-SYT5 antibody
This is a rabbit polyclonal antibody against SYT5. It was validated on Western Blot

Target Description: Synaptotagmins, such as SYT5, are a family of type III membrane proteins characterized by cytoplasmic repeats related to protein kinase C (see MIM 176960) regulatory (C2) domains, which are thought to bind calcium. Synaptotagmins may act both as negative regulators of vesicle fusion, allowing fusion in the presence of calcium, and as calcium receptors or sensor molecules (summary by Hudson and Birnbaum, 1995 [PubMed 7597049]).

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
synaptotagmin-5 isoform 1
NCBI Official Synonym Full Names
synaptotagmin 5
NCBI Official Symbol
SYT5
NCBI Protein Information
synaptotagmin-5
UniProt Protein Name
Synaptotagmin-5
Protein Family
UniProt Gene Name
SYT5
UniProt Synonym Gene Names
SytV
UniProt Entry Name
SYT5_HUMAN

NCBI Description

Synaptotagmins, such as SYT5, are a family of type III membrane proteins characterized by cytoplasmic repeats related to protein kinase C (see MIM 176960) regulatory (C2) domains, which are thought to bind calcium. Synaptotagmins may act both as negative regulators of vesicle fusion, allowing fusion in the presence of calcium, and as calcium receptors or sensor molecules (summary by Hudson and Birnbaum, 1995 [PubMed 7597049]).[supplied by OMIM, Feb 2011]

Uniprot Description

SYT5: May be involved in Ca(2+)-dependent exocytosis of secretory vesicles through Ca(2+) and phospholipid binding to the C2 domain or may serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis. Regulates the Ca(2+)- dependent secretion of norepinephrine in PC12 cells. Required for export from the endocytic recycling compartment to the cell surface. Belongs to the synaptotagmin family.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 19q13.42|11p

Cellular Component: neuron projection; cell soma; synaptic vesicle membrane; recycling endosome membrane; perinuclear region of cytoplasm; integral to membrane; cell junction

Molecular Function: clathrin binding; syntaxin binding; calcium-dependent phospholipid binding; protein heterodimerization activity; transporter activity; metal ion binding

Biological Process: synaptic transmission; energy reserve metabolic process; regulation of insulin secretion; calcium ion-dependent exocytosis

Research Articles on SYT5

Similar Products

Product Notes

The SYT5 syt5 (Catalog #AAA3214358) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SYT5 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SYT5 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the SYT5 syt5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YLLPDKRRRY ETKVHRQTLN PHFGETFAFK VPYVELGGRV LVMAVYDFDR. It is sometimes possible for the material contained within the vial of "SYT5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.