Western Blot (WB)
(Sample Type: Human, HamsterSample Type: 1. Hamster CHO K1 cells (20ug)2. HeLa skin cells(20ug)3. HEK273 cells (20ug)4. Human Skin Fibroblats (100ug)Primary Dilution: 1:800Secondary Antibody: Clean-Blot IP detection Reagent and KitSecondary Dilution: 1:2000Image Submitted By: V. Skopova, M. ZikanovaInstitute of Inherited Metabolic Disorders, Charles University in Prague and General Hopspital in Prague )
Rabbit ATIC Polyclonal Antibody | anti-ATIC antibody
ATIC antibody - N-terminal region
Gene Names
ATIC; PURH; AICAR; AICARFT; IMPCHASE; HEL-S-70p
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
ATIC; Polyclonal Antibody; ATIC antibody - N-terminal region; anti-ATIC antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKG
Sequence Length
592
Applicable Applications for anti-ATIC antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ATIC
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Sample Type: Human, HamsterSample Type: 1. Hamster CHO K1 cells (20ug)2. HeLa skin cells(20ug)3. HEK273 cells (20ug)4. Human Skin Fibroblats (100ug)Primary Dilution: 1:800Secondary Antibody: Clean-Blot IP detection Reagent and KitSecondary Dilution: 1:2000Image Submitted By: V. Skopova, M. ZikanovaInstitute of Inherited Metabolic Disorders, Charles University in Prague and General Hopspital in Prague )
Western Blot (WB)
(Sample Type: Human, HamsterSample Type: 1. Hamster CHO K1 cells (20ug)2. HeLa skin cells(20ug)3. HEK273 cells (20ug)4. Human Skin Fibroblats (100ug)Primary Dilution: 1:800Secondary Antibody: Clean-Blot IP detection Reagent and KitSecondary Dilution: 1:2000Image Submitted By: V. Skopova, M. ZikanovaInstitute of Inherited Metabolic Disorders, Charles University in Prague and General Hopspital in Prague )
Western Blot (WB)
(WB Suggested Anti-ATIC Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysateATIC is supported by BioGPS gene expression data to be expressed in HepG2)
Western Blot (WB)
(WB Suggested Anti-ATIC Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysateATIC is supported by BioGPS gene expression data to be expressed in HepG2)
Related Product Information for anti-ATIC antibody
This is a rabbit polyclonal antibody against ATIC. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: ATIC is a bifunctional protein requiring dimerization for transformylase activity.
Target Description: ATIC is a bifunctional protein requiring dimerization for transformylase activity.
Product Categories/Family for anti-ATIC antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64kDa
NCBI Official Full Name
bifunctional purine biosynthesis protein PURH
NCBI Official Synonym Full Names
5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase
NCBI Official Symbol
ATIC
NCBI Official Synonym Symbols
PURH; AICAR; AICARFT; IMPCHASE; HEL-S-70p
NCBI Protein Information
bifunctional purine biosynthesis protein PURH
UniProt Protein Name
Bifunctional purine biosynthesis protein PURH
UniProt Gene Name
ATIC
UniProt Synonym Gene Names
PURH
UniProt Entry Name
PUR9_HUMAN
NCBI Description
This gene encodes a bifunctional protein that catalyzes the last two steps of the de novo purine biosynthetic pathway. The N-terminal domain has phosphoribosylaminoimidazolecarboxamide formyltransferase activity, and the C-terminal domain has IMP cyclohydrolase activity. A mutation in this gene results in AICA-ribosiduria. [provided by RefSeq, Sep 2009]
Research Articles on ATIC
Similar Products
Product Notes
The ATIC atic (Catalog #AAA3208049) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ATIC antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ATIC can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ATIC atic for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YVVVSTEMQS SESKDTSLET RRQLALKAFT HTAQYDEAIS DYFRKQYSKG. It is sometimes possible for the material contained within the vial of "ATIC, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
