Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-SYCP2 Polyclonal Antibody)

Rabbit SYCP2 Polyclonal Antibody | anti-SYCP2 antibody

SYCP2 Polyclonal Antibody

Gene Names
SYCP2; SCP2; SCP-2
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
SYCP2; Polyclonal Antibody; SYCP2 Polyclonal Antibody; SCP-2; SCP2; synaptonemal complex protein 2; anti-SYCP2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
3.31 mg/ml (varies by lot)
Sequence Length
1024
Applicable Applications for anti-SYCP2 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1231-1530 of human SYCP2 (NP_055073.2).
Immunogen Sequence
EIESPHINENYIQSKREESHLASSLSKSSEGREKTWFDMPCDATHVSGPTQHLSRKRIYIEDNLSNSNEVEMEEKGERRANLLPKKLCKIEDADHHIHKMSESVSSLSTNDFSIPWETWQNEFAGIEMTYETYERLNSEFKRRNNIRHKMLSYFTTQSWKTAQQHLRTMNHQSQDSRIKKLDKFQFIIIEELENFEKDSQSLKDLEKEFVDFWEKIFQKFSAYQKSEQQRLHLLKTSLAKSVFCNTDSEETVFTSEMCLMKEDMKVLQDRLLKDMLEEELLNVRRELMSVFMSHERNANV
Positive Samples
293T, Mouse Testis, Rat Testis
Cellular Location
Chromosome, Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-SYCP2 Polyclonal Antibody)

Western Blot (WB) (Western blot-SYCP2 Polyclonal Antibody)
Related Product Information for anti-SYCP2 antibody
The synaptonemal complex is a proteinaceous structure that links homologous chromosomes during the prophase of meiosis. The protein encoded by this gene is a major component of the synaptonemal complex and may bind DNA at scaffold attachment regions. The encoded protein requires synaptonemal complex protein 3, but not 1, for inclusion in the synaptonemal complex.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
Calculated: 175kDa
Observed: 176kDa
NCBI Official Full Name
SYCP2 protein, partial
NCBI Official Synonym Full Names
synaptonemal complex protein 2
NCBI Official Symbol
SYCP2
NCBI Official Synonym Symbols
SCP2; SCP-2
NCBI Protein Information
synaptonemal complex protein 2
UniProt Protein Name
Synaptonemal complex protein 2
UniProt Gene Name
SYCP2
UniProt Synonym Gene Names
SCP2; SCP-2; hsSCP2
UniProt Entry Name
SYCP2_HUMAN

NCBI Description

The synaptonemal complex is a proteinaceous structure that links homologous chromosomes during the prophase of meiosis. The protein encoded by this gene is a major component of the synaptonemal complex and may bind DNA at scaffold attachment regions. The encoded protein requires synaptonemal complex protein 3, but not 1, for inclusion in the synaptonemal complex. [provided by RefSeq, Jul 2008]

Uniprot Description

SYCP2: Major component of the axial/lateral elements of synaptonemal complexes (SCS) during meiotic prophase. May be involved in the organization of chromatin by temporarily binding to DNA scaffold attachment regions. Requires SYCP3, but not SYCP1, in order to be incorporated into the axial/lateral elements. Belongs to the SYCP2 family.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 20q13.33

Cellular Component: lateral element; synaptonemal complex; nucleus

Molecular Function: DNA binding; protein heterodimerization activity

Biological Process: synaptonemal complex assembly; fertilization; cell division; male genitalia morphogenesis; female meiosis; male meiosis; negative regulation of apoptosis

Research Articles on SYCP2

Similar Products

Product Notes

The SYCP2 sycp2 (Catalog #AAA9140713) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SYCP2 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SYCP2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the SYCP2 sycp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SYCP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.