Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SUZ12 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysateSUZ12 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Rabbit SUZ12 Polyclonal Antibody | anti-SUZ12 antibody

SUZ12 antibody - C-terminal region

Gene Names
SUZ12; CHET9; JJAZ1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SUZ12; Polyclonal Antibody; SUZ12 antibody - C-terminal region; anti-SUZ12 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ESASPANEEITEEQNGTANGFSEINSKEKALETDSVSGVSKQSKKQKL
Sequence Length
739
Applicable Applications for anti-SUZ12 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human SUZ12
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SUZ12 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysateSUZ12 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Western Blot (WB) (WB Suggested Anti-SUZ12 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysateSUZ12 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)
Related Product Information for anti-SUZ12 antibody
This is a rabbit polyclonal antibody against SUZ12. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: A chromosomal aberration involving SUZ12 may be a cause of endometrial stromal tumors. Translocation t (7;17)(p15;q21) with JAZF1 generates the JAZF1-SUZ12 oncogene consisting of the N-terminus part of JAZF1 and the C-terminus part of SUZ12. It is frequently found in all cases of endometrial stromal tumors, except in endometrial stromal sarcomas, where it is rarer.This zinc finger gene has been identified at the breakpoints of a recurrent chromosomal translocation reported in endometrial stromal sarcoma. Recombination of these breakpoints results in the fusion of this gene and JAZF1. The protein encoded by this gene contains a zinc finger domain in the C terminus of the coding region. The specific function of this gene has not yet been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
83kDa
NCBI Official Full Name
polycomb protein SUZ12 isoform 1
NCBI Official Synonym Full Names
SUZ12 polycomb repressive complex 2 subunit
NCBI Official Symbol
SUZ12
NCBI Official Synonym Symbols
CHET9; JJAZ1
NCBI Protein Information
polycomb protein SUZ12
UniProt Protein Name
Polycomb protein SUZ12
Protein Family
UniProt Gene Name
SUZ12
UniProt Synonym Gene Names
CHET9; JJAZ1; KIAA0160; ChET 9 protein
UniProt Entry Name
SUZ12_HUMAN

NCBI Description

This zinc finger gene has been identified at the breakpoints of a recurrent chromosomal translocation reported in endometrial stromal sarcoma. Recombination of these breakpoints results in the fusion of this gene and JAZF1. The protein encoded by this gene contains a zinc finger domain in the C terminus of the coding region. [provided by RefSeq, Jul 2009]

Uniprot Description

SUZ12: a zinc finger protein. A breakpoint translocation of the cognate gene with JAZF1 has been reported in endometrial stromal sarcoma.

Protein type: Oncoprotein; C2H2-type zinc finger protein; Transcription factor

Chromosomal Location of Human Ortholog: 17q11.2

Cellular Component: nucleoplasm; sex chromatin; ESC/E(Z) complex; nucleolus; nucleus

Molecular Function: histone methyltransferase activity; protein binding; sequence-specific DNA binding; RNA binding; metal ion binding; chromatin binding; methylated histone residue binding

Biological Process: histone methylation; negative regulation of cell differentiation; transcription, DNA-dependent; negative regulation of gene expression, epigenetic; histone ubiquitination; positive regulation of cell proliferation; gene expression; negative regulation of transcription from RNA polymerase II promoter; regulation of gene expression, epigenetic

Research Articles on SUZ12

Similar Products

Product Notes

The SUZ12 suz12 (Catalog #AAA3204482) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SUZ12 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SUZ12 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SUZ12 suz12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ESASPANEEI TEEQNGTANG FSEINSKEKA LETDSVSGVS KQSKKQKL. It is sometimes possible for the material contained within the vial of "SUZ12, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.