Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SULT1E1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)

Rabbit SULT1E1 Polyclonal Antibody | anti-SULT1E1 antibody

SULT1E1 antibody - middle region

Gene Names
SULT1E1; EST; STE; EST-1; ST1E1
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SULT1E1; Polyclonal Antibody; SULT1E1 antibody - middle region; anti-SULT1E1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFY
Sequence Length
294
Applicable Applications for anti-SULT1E1 antibody
Western Blot (WB)
Homology
Dog: 85%; Guinea Pig: 92%; Horse: 86%; Human: 100%; Mouse: 83%; Rabbit: 92%; Rat: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SULT1E1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SULT1E1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-SULT1E1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)
Related Product Information for anti-SULT1E1 antibody
This is a rabbit polyclonal antibody against SULT1E1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a protein that transfers a sulfo moiety to and from estrone, which may control levels of estrogen receptors.
Product Categories/Family for anti-SULT1E1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35
NCBI Official Full Name
estrogen sulfotransferase
NCBI Official Synonym Full Names
sulfotransferase family 1E member 1
NCBI Official Symbol
SULT1E1
NCBI Official Synonym Symbols
EST; STE; EST-1; ST1E1
NCBI Protein Information
estrogen sulfotransferase
UniProt Protein Name
Estrogen sulfotransferase
Protein Family
UniProt Gene Name
SULT1E1
UniProt Synonym Gene Names
STE; ST1E1
UniProt Entry Name
ST1E1_HUMAN

NCBI Description

Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a protein that transfers a sulfo moiety to and from estrone, which may control levels of estrogen receptors. [provided by RefSeq, Jul 2008]

Uniprot Description

SULT1E1: Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of estradiol and estrone. May play a role in the regulation of estrogen receptor activity by metabolizing free estradiol. Maximally sulfates beta-estradiol and estrone at concentrations of 20 nM. Also sulfates dehydroepiandrosterone, pregnenolone, ethinylestradiol, equalenin, diethylstilbesterol and 1-naphthol, at significantly higher concentrations; however, cortisol, testosterone and dopamine are not sulfated. Belongs to the sulfotransferase 1 family.

Protein type: EC 2.8.2.4; Transferase; Energy Metabolism - sulfur; Lipid Metabolism - androgen and estrogen

Chromosomal Location of Human Ortholog: 4q13.1

Cellular Component: cytosol

Molecular Function: steroid sulfotransferase activity; estrone sulfotransferase activity; flavonol 3-sulfotransferase activity; steroid binding

Biological Process: steroid metabolic process; estrogen metabolic process; xenobiotic metabolic process; sulfation; female pregnancy; 3'-phosphoadenosine 5'-phosphosulfate metabolic process

Research Articles on SULT1E1

Similar Products

Product Notes

The SULT1E1 sult1e1 (Catalog #AAA3209116) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SULT1E1 antibody - middle region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SULT1E1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SULT1E1 sult1e1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LMVAGHPNPG SFPEFVEKFM QGQVPYGSWY KHVKSWWEKG KSPRVLFLFY. It is sometimes possible for the material contained within the vial of "SULT1E1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.