Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (SULT1C4 antibody (MBS5301786) used at 1 ug/ml to detect target protein.)

Rabbit SULT1C4 Polyclonal Antibody | anti-SULT1C4 antibody

SULT1C4 antibody

Gene Names
SULT1C4; SULT1C; SULT1C2
Applications
Western Blot
Purity
Affinity purified
Synonyms
SULT1C4; Polyclonal Antibody; SULT1C4 antibody; Polyclonal SULT1C4; Anti-SULT1C4; SULT1C; SULTC4 1; SULT1C2; MGC149521; Sulfotransferase Family Cytosolic 1C Member 4; SULTC4-1; MGC34422; anti-SULT1C4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
SULT1C4 antibody was raised against the middle region of SULT1C4
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SULT1C4 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
227
Applicable Applications for anti-SULT1C4 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
SULT1C4 catalyzes the sulfate conjugation of many drugs, xenobiotic compounds, hormones, and neurotransmitters. It may be involved in the activation of carcinogenic hyroxylamines. SULT1C4 shows activity towards p-nitrophenol and N-hydroxy-2-acetylamino-fluorene (N-OH-2AAF).Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities.
Cross-Reactivity
Human
Immunogen
SULT1C4 antibody was raised using the middle region of SULT1C4 corresponding to a region with amino acids HEHVKGWWEAKDKHRILYLFYEDMKKNPKHEIQKLAEFIGKKLDDKVLDK
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(SULT1C4 antibody (MBS5301786) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (SULT1C4 antibody (MBS5301786) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-SULT1C4 antibody
Rabbit polyclonal SULT1C4 antibody raised against the middle region of SULT1C4
Product Categories/Family for anti-SULT1C4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
35 kDa (MW of target protein)
NCBI Official Full Name
SULT1C4 protein
NCBI Official Synonym Full Names
sulfotransferase family, cytosolic, 1C, member 4
NCBI Official Symbol
SULT1C4
NCBI Official Synonym Symbols
SULT1C; SULT1C2
NCBI Protein Information
sulfotransferase 1C4
UniProt Protein Name
Sulfotransferase 1C4
Protein Family
UniProt Gene Name
SULT1C4
UniProt Synonym Gene Names
SULT1C2; ST1C4; SULT1C#2
UniProt Entry Name
ST1C4_HUMAN

NCBI Description

Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a protein that belongs to the SULT1 subfamily, responsible for transferring a sulfo moiety from PAPS to phenol-containing compounds. [provided by RefSeq, Jul 2008]

Uniprot Description

SULT1C4: Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of drugs, xenobiotic compounds, hormones, and neurotransmitters. May be involved in the activation of carcinogenic hyroxylamines. Shows activity towards p-nitrophenol and N-hydroxy-2-acetylamino-fluorene (N-OH-2AAF). Belongs to the sulfotransferase 1 family.

Protein type: Transferase; EC 2.8.2.-

Chromosomal Location of Human Ortholog: 2q12.3

Cellular Component: cytosol

Molecular Function: sulfotransferase activity

Biological Process: xenobiotic metabolic process; sulfation; 3'-phosphoadenosine 5'-phosphosulfate metabolic process

Similar Products

Product Notes

The SULT1C4 sult1c4 (Catalog #AAA5301786) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SULT1C4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the SULT1C4 sult1c4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SULT1C4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.