Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human Stratifin Polyclonal Antibody | anti-SFN antibody

Stratifin (SFN, SFN Protein, 14-3-3 Protein sigma, 14-3-3 sigma, Epithelial Cell Marker Protein 1, Er, HME1, Mme1, OTTHUMP00000004242, YWHAS) (MaxLight 650)

Gene Names
SFN; YWHAS
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Stratifin; Polyclonal Antibody; Stratifin (SFN; SFN Protein; 14-3-3 Protein sigma; 14-3-3 sigma; Epithelial Cell Marker Protein 1; Er; HME1; Mme1; OTTHUMP00000004242; YWHAS) (MaxLight 650); anti-SFN antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SFN.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-SFN antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human SFN, aa1-248 (NP_006133.1).
Immunogen Sequence
MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS
Conjugate
MaxLight650
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-SFN antibody
14-3-3 sigma, also known as Stratifin (SFN), belong to the 14-3-3 family. The 14-3-3 family of proteins plays a key regulatory role in signal transduction, checkpoint control, apoptotic and nutrient-sensing pathways. 14-3-3 proteins are highly conserved and ubiquitously expressed. There are at least seven isoforms, beta, gamma, epsilon, sigma, zeta, tau and eta that have been identified in mammals. 14-3-3 sigma was identified as an epithelial cell marker and appeared to function as a tumor suppressor whose expression can be down regulated via methylation. Loss of 14-3-3 sigma expression results in a defective G2/M phase checkpoint and appears to contribute to both epithelial and non-epithelial tumorigenesis.
Product Categories/Family for anti-SFN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24,336 Da
NCBI Official Full Name
14-3-3 protein sigma
NCBI Official Synonym Full Names
stratifin
NCBI Official Symbol
SFN
NCBI Official Synonym Symbols
YWHAS
NCBI Protein Information
14-3-3 protein sigma; 14-3-3 sigma; epithelial cell marker protein 1
UniProt Protein Name
14-3-3 protein sigma
Protein Family
UniProt Gene Name
SFN
UniProt Synonym Gene Names
HME1
UniProt Entry Name
1433S_HUMAN

Uniprot Description

14-3-3 sigma: Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. When bound to KRT17, regulates protein synthesis and epithelial cell growth by stimulating Akt/mTOR pathway. Homodimer. Interacts with KRT17 and SAMSN1. Found in a complex with XPO7, EIF4A1, ARHGAP1, VPS26A, VPS29, VPS35 and SFN. Interacts with GAB2. Interacts with SRPK2. Present mainly in tissues enriched in stratified squamous keratinizing epithelium. Belongs to the 14-3-3 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 1p36.11

Cellular Component: extracellular space; cytoplasmic vesicle membrane; cytoplasm; nucleus; cytosol

Molecular Function: protein kinase C inhibitor activity; protein domain specific binding; protein binding; phosphoprotein binding; protein kinase binding

Biological Process: positive regulation of protein export from nucleus; regulation of epidermal cell division; release of cytochrome c from mitochondria; DNA damage response, signal transduction resulting in induction of apoptosis; apoptosis; keratinization; positive regulation of epidermal cell differentiation; negative regulation of protein kinase activity; regulation of cyclin-dependent protein kinase activity; negative regulation of caspase activity; signal transduction; positive regulation of cell growth

Research Articles on SFN

Similar Products

Product Notes

The SFN sfn (Catalog #AAA6395496) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Stratifin (SFN, SFN Protein, 14-3-3 Protein sigma, 14-3-3 sigma, Epithelial Cell Marker Protein 1, Er, HME1, Mme1, OTTHUMP00000004242, YWHAS) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Stratifin can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SFN sfn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Stratifin, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.