Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of Mouse kidney, using STK35 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

Rabbit anti-Mouse STK35 Polyclonal Antibody | anti-STK35 antibody

STK35 Rabbit pAb

Gene Names
STK35; CLIK1; STK35L1
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purification
Synonyms
STK35; Polyclonal Antibody; STK35 Rabbit pAb; CLIK1; STK35L1; anti-STK35 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
RPEGGGGSARPRYSLLAEIGRGSYGVVYEAVAGRSGARVAVKKIRCDAPENVELALAEFWALTSLKRRHQNVVQFEECVLQRNGLAQRMSHGNKSSQLYLRLVETSLKGERILGYAEEPCYLWFVMEFCEGGDLNQYVLSRRPDPATNKSFMLQLTSAIAFLHKNHIVHRDLKPDNILITERSGTPILKVA
Applicable Applications for anti-STK35 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 190-380 of human STK35 (NP_543026.2).
Positive Samples
Mouse kidney
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of Mouse kidney, using STK35 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

Western Blot (WB) (Western blot analysis of extracts of Mouse kidney, using STK35 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Related Product Information for anti-STK35 antibody
Background: The protein encoded by this gene is a kinase that is predominantly found in the nucleus. However, it can interact with PDLIM1/CLP-36 in the cytoplasm and localize to actin stress fibers. The encoded protein may be a regulator of actin stress fibers in nonmuscle cells. [provided by RefSeq, Jul 2008]

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58,051 Da
NCBI Official Full Name
serine/threonine-protein kinase 35
NCBI Official Synonym Full Names
serine/threonine kinase 35
NCBI Official Symbol
STK35
NCBI Official Synonym Symbols
CLIK1; STK35L1
NCBI Protein Information
serine/threonine-protein kinase 35
UniProt Protein Name
Serine/threonine-protein kinase 35
UniProt Gene Name
STK35
UniProt Synonym Gene Names
CLIK1; PDIK1; STK35L1; CLIK-1
UniProt Entry Name
STK35_HUMAN

NCBI Description

The protein encoded by this gene is a kinase that is predominantly found in the nucleus. However, it can interact with PDLIM1/CLP-36 in the cytoplasm and localize to actin stress fibers. The encoded protein may be a regulator of actin stress fibers in nonmuscle cells. [provided by RefSeq, Jul 2008]

Uniprot Description

Catalytic activity: ATP + a protein = ADP + a phosphoprotein.

Subunit structure: Interacts with PDLIM1/CLP-36.

Subcellular location: Nucleus. Nucleus › nucleolus. Cytoplasm. Note: When associated with PDLIM1, it is mostly found in cytoplasm, localized to actin stress fibers (Ref.5). However, Ref.1 detected STK35 only in the nucleus, and the presence of PDLIM1 had no influence on its location. Ref.1 Ref.5

Tissue specificity: Expressed in testis.

Post-translational modification: Autophosphorylated. Ref.5

Miscellaneous: Association with PDLIM1 is controversial (Ref.5).

Sequence similarities: Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.Contains 1 protein kinase domain.

Sequence caution: The sequence AAI40884.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.The sequence AAI40885.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.The sequence BAG37270.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.The sequence CAI15590.1 differs from that shown. Reason: Erroneous gene model prediction.

Research Articles on STK35

Similar Products

Product Notes

The STK35 stk35 (Catalog #AAA9143050) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STK35 Rabbit pAb reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's STK35 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the STK35 stk35 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RPEGGGGSAR PRYSLLAEIG RGSYGVVYEA VAGRSGARVA VKKIRCDAPE NVELALAEFW ALTSLKRRHQ NVVQFEECVL QRNGLAQRMS HGNKSSQLYL RLVETSLKGE RILGYAEEPC YLWFVMEFCE GGDLNQYVLS RRPDPATNKS FMLQLTSAIA FLHKNHIVHR DLKPDNILIT ERSGTPILKV A. It is sometimes possible for the material contained within the vial of "STK35, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.