Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: STK3Sample Tissue: Human LN18 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human STK3 Polyclonal Antibody | anti-STK3 antibody

STK3 Antibody - middle region

Gene Names
STK3; KRS1; MST2
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
STK3; Polyclonal Antibody; STK3 Antibody - middle region; anti-STK3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GTMKRNATSPQVQRPSFMDYFDKQDFKNKSHENCNQNMHEPFPMSKNVFP
Sequence Length
491
Applicable Applications for anti-STK3 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human STK3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: STK3Sample Tissue: Human LN18 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: STK3Sample Tissue: Human LN18 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-STK3 antibody
This gene encodes a serine/threonine protein kinase activated by proapoptotic molecules indicating the encoded protein functions as a growth suppressor. Cleavage of the protein product by caspase removes the inhibitory C-terminal portion. The N-terminal portion is transported to the nucleus where it homodimerizes to form the active kinase which promotes the condensation of chromatin during apoptosis. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-STK3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54 kDa
NCBI Official Full Name
serine/threonine-protein kinase 3 isoform 2
NCBI Official Synonym Full Names
serine/threonine kinase 3
NCBI Official Symbol
STK3
NCBI Official Synonym Symbols
KRS1; MST2
NCBI Protein Information
serine/threonine-protein kinase 3
UniProt Protein Name
Serine/threonine-protein kinase 3
UniProt Gene Name
STK3
UniProt Synonym Gene Names
KRS1; MST2; MST-2; MST2/N; MST2/C

NCBI Description

This gene encodes a serine/threonine protein kinase activated by proapoptotic molecules indicating the encoded protein functions as a growth suppressor. Cleavage of the protein product by caspase removes the inhibitory C-terminal portion. The N-terminal portion is transported to the nucleus where it homodimerizes to form the active kinase which promotes the condensation of chromatin during apoptosis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2012]

Uniprot Description

MST2: a protein kinase of the STE20 family. Activated by apoptotic signals as well as other stress conditions. Full activation requires both phosphorylation and caspase-mediated cleavage. Following cleavage by caspase-3, undergoes irreversible autophosphorylation. Full-length is mainly unphosphorylated in the rat thymus and cultured cells, whereas caspase-3-cleaved MST2 in apoptotic cells is highly phosphorylated.

Protein type: Autophagy; EC 2.7.11.1; Kinase, protein; MST subfamily; Protein kinase, STE; Protein kinase, Ser/Thr (non-receptor); STE group; STE20 family

Chromosomal Location of Human Ortholog: 8q22.2

Cellular Component: cytoplasm; cytosol; protein complex

Molecular Function: ATP binding; magnesium ion binding; protein binding; protein dimerization activity; protein kinase activity; protein serine/threonine kinase activator activity; protein serine/threonine kinase activity; receptor signaling protein serine/threonine kinase activity

Biological Process: apoptosis; positive regulation of apoptosis; positive regulation of protein binding; positive regulation of transcription factor activity; protein amino acid phosphorylation; protein stabilization; signal transduction

Research Articles on STK3

Similar Products

Product Notes

The STK3 stk3 (Catalog #AAA3224287) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STK3 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's STK3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the STK3 stk3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GTMKRNATSP QVQRPSFMDY FDKQDFKNKS HENCNQNMHE PFPMSKNVFP. It is sometimes possible for the material contained within the vial of "STK3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.