Rabbit anti-Human MMP20 Polyclonal Antibody | anti-MMP20 antibody

MMP20 (Matrix Metalloproteinase-20, MMP-20, Enamel Metalloproteinase, Enamelysin) (HRP)

Cat. Num. AAA6385658

• Gene Names: MMP20; AI2A2; MMP-20
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MMP20; Polyclonal Antibody; MMP20 (Matrix Metalloproteinase-20; MMP-20; Enamel Metalloproteinase; Enamelysin) (HRP); anti-MMP20 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human MMP20.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.4.

• Applicable Applications for anti-MMP20 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length protein corresponding to aa1-483 from human MMP20 (NM_004771.3; NP_004762.2)
• Immunogen Sequence: MKVLPASGLAVFLIMALKFSTAAPSLVAASPRTWRNNYRLAQAYLDKYYTNKEGHQIGEMVARGSNSMIRKIKELQAFFGLQVTGKLDQTTMNVIKKPRCGVPDVANYRLFPGEPKWKKNTLTYRISKYTPSMSSVEVDKAVEMALQAWSSAVPLSFVRINSGEADIMISFENGDHGDSYPFDGPRGTLAHAFAPGEGLGGDTHFDNAEKWTMGTNGFNLFTVAAHEFGHALGLAHSTDPSALMYPTYKYKNPYGFHLPKDDVKGIQALYGPRKVFLGKPTLPHAPHHKPSIPDLCDSSSSFDAVTMLGKELLLFKDRIFWRRQVHLRTGIRPSTITSSFPQLMSNVDAAYEVAERGTAYFFKGPHYWITRGFQMQGPPRTIYDFGFPRHVQQIDAAVYLREPQKTLFFVGDEYYSYDERKRKMEKDYPKNTEEEFSGVNGQIDAAVELNGYIYFFSGPKTYKYDTEKEDVVSVVKSSSWIGC
• Conjugate: HRP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of MMP20 expression in HepG2 usingMBS648727.)

Western Blot (WB)

(Western Blot analysis of MMP20 expression in transfected 293T cell line usingMBS648727. Lane 1: MMP20 transfected lysate (53.13kD). Lane 2: Non-transfected lysate.)

Product Categories/Family for anti-MMP20 antibody

Antibodies; Matrix Metalloproteinases

NCBI and Uniprot Product Information

• NCBI GI #: 45359865
• NCBI GeneID: 9313
• NCBI Accession #: NP_004762.2
• NCBI GenBank Nucleotide #: NM_004771.3
• UniProt Accession #: O60882; Q6DKT9
• Molecular Weight: 54,387 Da
• NCBI Official Full Name: matrix metalloproteinase-20 preproprotein
• NCBI Official Synonym Full Names: matrix metallopeptidase 20
• NCBI Official Symbol: MMP20
• NCBI Official Synonym Symbols: AI2A2; MMP-20
• NCBI Protein Information: matrix metalloproteinase-20
• UniProt Protein Name: Matrix metalloproteinase-20
• Protein Family: Matrix metalloproteinase
• UniProt Gene Name: MMP20
• UniProt Synonym Gene Names: MMP-20

NCBI Description

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The protein encoded by this gene degrades amelogenin, the major protein component of dental enamel matrix, and thus thought to play a role in tooth enamel formation. A mutation in this gene, which alters the normal splice pattern and results in premature termination of the encoded protein, has been associated with amelogenesis imperfecta. This gene is part of a cluster of MMP genes located on chromosome 11q22.3. [provided by RefSeq, Aug 2011]

Uniprot Description

Degrades amelogenin, the major protein component of the enamel matrix and two of the macromolecules characterizing the cartilage extracellular matrix: aggrecan and the cartilage oligomeric matrix protein (COMP). May play a central role in tooth enamel formation. Cleaves aggrecan at the '360-Asn-|-Phe-361' site.