Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: STC2Sample Tissue: Human NCI-H226 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human STC2 Polyclonal Antibody | anti-STC2 antibody

STC2 Antibody - N-terminal region

Gene Names
STC2; STC-2; STCRP
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
STC2; Polyclonal Antibody; STC2 Antibody - N-terminal region; anti-STC2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ATFDPARGTDATNPPEGPQDRSSQQKGRLSLQNTAEIQHCLVNAGDVGCG
Sequence Length
302
Applicable Applications for anti-STC2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human STC2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: STC2Sample Tissue: Human NCI-H226 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: STC2Sample Tissue: Human NCI-H226 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-STC2 antibody
This gene encodes a secreted, homodimeric glycoprotein that is expressed in a wide variety of tissues and may have autocrine or paracrine functions. The encoded protein has 10 of its 15 cysteine residues conserved among stanniocalcin family members and is phosphorylated by casein kinase 2 exclusively on its serine residues. Its C-terminus contains a cluster of histidine residues which may interact with metal ions. The protein may play a role in the regulation of renal and intestinal calcium and phosphate transport, cell metabolism, or cellular calcium/phosphate homeostasis. Constitutive overexpression of human stanniocalcin 2 in mice resulted in pre- and postnatal growth restriction, reduced bone and skeletal muscle growth, and organomegaly. Expression of this gene is induced by estrogen and altered in some breast cancers.
Product Categories/Family for anti-STC2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33 kDa
NCBI Official Full Name
stanniocalcin-2
NCBI Official Synonym Full Names
stanniocalcin 2
NCBI Official Symbol
STC2
NCBI Official Synonym Symbols
STC-2; STCRP
NCBI Protein Information
stanniocalcin-2
UniProt Protein Name
Stanniocalcin-2
Protein Family
UniProt Gene Name
STC2
UniProt Synonym Gene Names
STC-2; STC-related protein; STCRP
UniProt Entry Name
STC2_HUMAN

NCBI Description

This gene encodes a secreted, homodimeric glycoprotein that is expressed in a wide variety of tissues and may have autocrine or paracrine functions. The encoded protein has 10 of its 15 cysteine residues conserved among stanniocalcin family members and is phosphorylated by casein kinase 2 exclusively on its serine residues. Its C-terminus contains a cluster of histidine residues which may interact with metal ions. The protein may play a role in the regulation of renal and intestinal calcium and phosphate transport, cell metabolism, or cellular calcium/phosphate homeostasis. Constitutive overexpression of human stanniocalcin 2 in mice resulted in pre- and postnatal growth restriction, reduced bone and skeletal muscle growth, and organomegaly. Expression of this gene is induced by estrogen and altered in some breast cancers. [provided by RefSeq, Jul 2008]

Uniprot Description

STC2: a secreted protein that has an anti-hypocalcemic action on calcium and phosphate homeostasis. Expressed in a variety of tissues including muscle, heart, pancreas, kidney, spleen, prostate, small intestine, colon and peripheral blood leucocytes.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 5q35.1

Cellular Component: Golgi apparatus; extracellular space; endoplasmic reticulum; perinuclear region of cytoplasm

Molecular Function: protein homodimerization activity; enzyme binding; hormone activity; heme binding

Biological Process: cellular calcium ion homeostasis; response to peptide hormone stimulus; response to vitamin D; negative regulation of multicellular organism growth; unfolded protein response; decidualization; response to oxidative stress; regulation of hormone biosynthetic process; embryo implantation

Research Articles on STC2

Similar Products

Product Notes

The STC2 stc2 (Catalog #AAA3221702) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STC2 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's STC2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the STC2 stc2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ATFDPARGTD ATNPPEGPQD RSSQQKGRLS LQNTAEIQHC LVNAGDVGCG. It is sometimes possible for the material contained within the vial of "STC2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.