Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (STAMBP polyclonal antibody. Western Blot analysis of STAMBP expression in human spleen.)

Mouse anti-Human STAMBP Polyclonal Antibody | anti-STAMBP antibody

STAMBP (STAM-binding Protein, Associated Molecule with the SH3 Domain of STAM, AMSH, Endosome-associated Ubiquitin Isopeptidase)

Gene Names
STAMBP; AMSH; MICCAP
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
STAMBP; Polyclonal Antibody; STAMBP (STAM-binding Protein; Associated Molecule with the SH3 Domain of STAM; AMSH; Endosome-associated Ubiquitin Isopeptidase); Anti -STAMBP (STAM-binding Protein; anti-STAMBP antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human STAMBP.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLFIEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPTLTVSSIQPSDCHTTVRPAKPPVVDRSLKPGALSNSESIPTIDGLRHVVVPGRLCPQFLQLASANTARGVETCGILCGKLMRNEFTITHVLIPKQSAGSDYCNTENEEELFLIQDQQGLITLGWIHTHPTQTAFLSSVDLHTHCSYQMMLPESVAIVCSPKFQETGFFKLTDHGLEEISSCRQKGFHPHSKDPPLFCSCSHVTVVDRAVTITDLR
Applicable Applications for anti-STAMBP antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full-length human STAMBP, aa1-424 (NP_006454.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(STAMBP polyclonal antibody. Western Blot analysis of STAMBP expression in human spleen.)

Western Blot (WB) (STAMBP polyclonal antibody. Western Blot analysis of STAMBP expression in human spleen.)

Western Blot (WB)

(Western Blot analysis of STAMBP expression in transfected 293T cell line by STAMBP polyclonal antibody. Lane 1: STAMBP transfected lysate (46.64kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of STAMBP expression in transfected 293T cell line by STAMBP polyclonal antibody. Lane 1: STAMBP transfected lysate (46.64kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-STAMBP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48,077 Da
NCBI Official Full Name
STAM-binding protein
NCBI Official Synonym Full Names
STAM binding protein
NCBI Official Symbol
STAMBP
NCBI Official Synonym Symbols
AMSH; MICCAP
NCBI Protein Information
STAM-binding protein; endosome-associated ubiquitin isopeptidase; associated molecule with the SH3 domain of STAM
UniProt Protein Name
STAM-binding protein
Protein Family
UniProt Gene Name
STAMBP
UniProt Synonym Gene Names
AMSH
UniProt Entry Name
STABP_HUMAN

NCBI Description

Cytokine-mediated signal transduction in the JAK-STAT cascade requires the involvement of adaptor molecules. One such signal-transducing adaptor molecule contains an SH3 domain that is required for induction of MYC and cell growth. The protein encoded by this gene binds to the SH3 domain of the signal-transducing adaptor molecule, and plays a critical role in cytokine-mediated signaling for MYC induction and cell cycle progression. Multiple alternatively spliced transcript variants encoding the same protein isoform have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

AMSH: an adaptor protein involved in cytokine signal transduction the JAK-STAT cascade. Binds to the SH3 domain of the signal-transducing adaptor molecule STAM (signal transducing adaptor molecule). May play a critical role in cytokine-mediated signaling for MYC induction and cell cycle progression.

Protein type: Protease; Ubiquitin-specific protease; EC 3.1.2.15; EC 3.4.19.-

Chromosomal Location of Human Ortholog: 2p13.1

Cellular Component: nucleoplasm; early endosome; cytoplasm; plasma membrane; nucleus; cleavage furrow

Molecular Function: protein domain specific binding; protein binding; metallopeptidase activity; metal ion binding; ubiquitin-specific protease activity

Biological Process: protein deubiquitination; cytokinesis after mitosis; positive regulation of cell proliferation; negative regulation of Ras protein signal transduction; negative regulation of neuron apoptosis; proteolysis; JAK-STAT cascade; negative regulation of phosphoinositide 3-kinase cascade

Disease: Microcephaly-capillary Malformation Syndrome

Research Articles on STAMBP

Similar Products

Product Notes

The STAMBP stambp (Catalog #AAA6004594) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The STAMBP (STAM-binding Protein, Associated Molecule with the SH3 Domain of STAM, AMSH, Endosome-associated Ubiquitin Isopeptidase) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's STAMBP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the STAMBP stambp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSDHGDVSLP PEDRVRALSQ LGSAVEVNED IPPRRYFRSG VEIIRMASIY SEEGNIEHAF ILYNKYITLF IEKLPKHRDY KSAVIPEKKD TVKKLKEIAF PKAEELKAEL LKRYTKEYTE YNEEKKKEAE ELARNMAIQQ ELEKEKQRVA QQKQQQLEQE QFHAFEEMIR NQELEKERLK IVQEFGKVDP GLGGPLVPDL EKPSLDVFPT LTVSSIQPSD CHTTVRPAKP PVVDRSLKPG ALSNSESIPT IDGLRHVVVP GRLCPQFLQL ASANTARGVE TCGILCGKLM RNEFTITHVL IPKQSAGSDY CNTENEEELF LIQDQQGLIT LGWIHTHPTQ TAFLSSVDLH THCSYQMMLP ESVAIVCSPK FQETGFFKLT DHGLEEISSC RQKGFHPHSK DPPLFCSCSH VTVVDRAVTI TDLR. It is sometimes possible for the material contained within the vial of "STAMBP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.