Western Blot (WB)
(WB Suggested Anti-ST6GALNAC5 Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)
Rabbit ST6GALNAC5 Polyclonal Antibody | anti-ST6GALNAC5 antibody
ST6GALNAC5 antibody - middle region
Gene Names
ST6GALNAC5; SIAT7E; SIAT7-E; ST6GalNAcV
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
ST6GALNAC5; Polyclonal Antibody; ST6GALNAC5 antibody - middle region; anti-ST6GALNAC5 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AFMITRHKMLQFDELFKQETGKDRKISNTWLSTGWFTMTIALELCDRINV
Sequence Length
336
Applicable Applications for anti-ST6GALNAC5 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ST6GALNAC5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-ST6GALNAC5 Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)
Western Blot (WB)
(WB Suggested Anti-ST6GALNAC5 Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)
Related Product Information for anti-ST6GALNAC5 antibody
This is a rabbit polyclonal antibody against ST6GALNAC5. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: ST6GALNAC5 belongs to a family of sialyltransferases that modify proteins and ceramides on the cell surface to alter cell-cell or cell-extracellular matrix interactions.ST6GALNAC5 belongs to a family of sialyltransferases that modify proteins and ceramides on the cell surface to alter cell-cell or cell-extracellular matrix interactions (Tsuchida et al., 2003 [PubMed 12668675]).[supplied by OMIM].
Target Description: ST6GALNAC5 belongs to a family of sialyltransferases that modify proteins and ceramides on the cell surface to alter cell-cell or cell-extracellular matrix interactions.ST6GALNAC5 belongs to a family of sialyltransferases that modify proteins and ceramides on the cell surface to alter cell-cell or cell-extracellular matrix interactions (Tsuchida et al., 2003 [PubMed 12668675]).[supplied by OMIM].
Product Categories/Family for anti-ST6GALNAC5 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5 isoform 1
NCBI Official Synonym Full Names
ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 5
NCBI Official Symbol
ST6GALNAC5
NCBI Official Synonym Symbols
SIAT7E; SIAT7-E; ST6GalNAcV
NCBI Protein Information
alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5
UniProt Protein Name
Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5
Protein Family
UniProt Gene Name
ST6GALNAC5
UniProt Synonym Gene Names
SIAT7E; ST6GalNAcV; SIAT7-E
UniProt Entry Name
SIA7E_HUMAN
NCBI Description
The protein encoded by this gene is a Golgi type II transmembrane glycosyltransferase. The encoded protein catalyzes the transfer of sialic acid to cell surface proteins to modulate cell-cell interactions. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2016]
Research Articles on ST6GALNAC5
Similar Products
Product Notes
The ST6GALNAC5 st6galnac5 (Catalog #AAA3209735) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ST6GALNAC5 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ST6GALNAC5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ST6GALNAC5 st6galnac5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AFMITRHKML QFDELFKQET GKDRKISNTW LSTGWFTMTI ALELCDRINV. It is sometimes possible for the material contained within the vial of "ST6GALNAC5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
