Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-SREBF2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Cytoplasmic in golgiPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit SREBF2 Polyclonal Antibody | anti-SREBF2 antibody

SREBF2 antibody - middle region

Gene Names
SREBF2; SREBP2; bHLHd2; SREBP-2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
SREBF2; Polyclonal Antibody; SREBF2 antibody - middle region; anti-SREBF2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VMMGQEKVPIKQVPGGVKQLEPPKEGERRTTHNIIEKRYRSSINDKIIEL
Sequence Length
681
Applicable Applications for anti-SREBF2 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SREBF2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-SREBF2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Cytoplasmic in golgiPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Rabbit Anti-SREBF2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Cytoplasmic in golgiPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(WB Suggested Anti-SREBF2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:7812500Positive Control: Transfected 293TSREBF2 is supported by BioGPS gene expression data to be expressed in HEK293T)

Western Blot (WB) (WB Suggested Anti-SREBF2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:7812500Positive Control: Transfected 293TSREBF2 is supported by BioGPS gene expression data to be expressed in HEK293T)
Related Product Information for anti-SREBF2 antibody
This is a rabbit polyclonal antibody against SREBF2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SREBF2 encodes a ubiquitously expressed transcription factor that controls cholesterol homeostasis by stimulating transcription of sterol-regulated genes. The encoded protein contains a basic helix-loop-helix-leucine zipper (bHLH-Zip) domain.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
74kDa
NCBI Official Full Name
SREBF2 protein
NCBI Official Synonym Full Names
sterol regulatory element binding transcription factor 2
NCBI Official Symbol
SREBF2
NCBI Official Synonym Symbols
SREBP2; bHLHd2; SREBP-2
NCBI Protein Information
sterol regulatory element-binding protein 2
UniProt Protein Name
Sterol regulatory element-binding protein 2
UniProt Gene Name
SREBF2
UniProt Synonym Gene Names
BHLHD2; SREBP2; SREBP-2; bHLHd2
UniProt Entry Name
SRBP2_HUMAN

NCBI Description

This gene encodes a member of the a ubiquitously expressed transcription factor that controls cholesterol homeostasis by regulating transcription of sterol-regulated genes. The encoded protein contains a basic helix-loop-helix-leucine zipper (bHLH-Zip) domain and binds the sterol regulatory element 1 motif. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]

Uniprot Description

SREBP-2: Transcriptional activator required for lipid homeostasis. Regulates transcription of the LDL receptor gene as well as the cholesterol and to a lesser degree the fatty acid synthesis pathway. Binds the sterol regulatory element 1 (SRE-1) (5'-ATCACCCCAC-3') found in the flanking region of the LDRL and HMG-CoA synthase genes. Belongs to the SREBP family.

Protein type: Transcription factor; Membrane protein, multi-pass; Membrane protein, integral; DNA-binding

Chromosomal Location of Human Ortholog: 22q13

Cellular Component: Golgi membrane; nucleoplasm; endoplasmic reticulum membrane; endoplasmic reticulum; cytoplasm; nucleolus; cytosol; nucleus

Molecular Function: protein dimerization activity; protein C-terminus binding; protein binding; C-8 sterol isomerase activity

Biological Process: cholesterol metabolic process; transcription, DNA-dependent; response to low density lipoprotein stimulus; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription from RNA polymerase II promoter; lipid metabolic process; cellular lipid metabolic process

Research Articles on SREBF2

Similar Products

Product Notes

The SREBF2 srebf2 (Catalog #AAA3224567) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SREBF2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SREBF2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). Researchers should empirically determine the suitability of the SREBF2 srebf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VMMGQEKVPI KQVPGGVKQL EPPKEGERRT THNIIEKRYR SSINDKIIEL. It is sometimes possible for the material contained within the vial of "SREBF2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.