Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of SPRED1 expression in transfected 293T cell line by SPRED1 polyclonal antibody. Lane 1: SPRED1 transfected lysate (50.5kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human SPRED1 Polyclonal Antibody | anti-SPRED1 antibody

SPRED1 (Sprouty-related, EVH1 Domain-containing Protein 1, Spred-1, hSpred1, NFLS) (AP)

Gene Names
SPRED1; NFLS; hSpred1; spred-1; PPP1R147
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SPRED1; Polyclonal Antibody; SPRED1 (Sprouty-related; EVH1 Domain-containing Protein 1; Spred-1; hSpred1; NFLS) (AP); anti-SPRED1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SPRED1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-SPRED1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human SPRED1, aa1-444 (NP_689807.1).
Immunogen Sequence
MSEETATSDNDNSYARVRAVVMTRDDSSGGWLPLGGSGLSSVTVFKVPHQEENGCADFFIRGERLRDKMVVLECMLKKDLIYNKVTPTFHHWKIDDKKFGLTFQSPADARAFDRGIRRAIEDISQGCPESKNEAEGADDLQANEEDSSSSLVKDHLFQQETVVTSEPYRSSNIRPSPFEDLNARRVYMQSQANQITFGQPGLDIQSRSMEYVQRQISKECGSLKSQNRVPLKSIRHVSFQDEDEIVRINPRDILIRRYADYRHPDMWKNDLERDDADSSIQFSKPDSKKSDYLYSCGDETKLSSPKDSVVFKTQPSSLKIKKSKRRKEDGERSRCVYCQERFNHEENVRGKCQDAPDPIKRCIYQVSCMLCAESMLYHCMSDSEGDFSDPCSCDTSDDKFCLRWLALVALSFIVPCMCCYVPLRMCHRCGEACGCCGGKHKAAG
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of SPRED1 expression in transfected 293T cell line by SPRED1 polyclonal antibody. Lane 1: SPRED1 transfected lysate (50.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SPRED1 expression in transfected 293T cell line by SPRED1 polyclonal antibody. Lane 1: SPRED1 transfected lysate (50.5kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-SPRED1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50,477 Da
NCBI Official Full Name
sprouty-related, EVH1 domain-containing protein 1
NCBI Official Synonym Full Names
sprouty related, EVH1 domain containing 1
NCBI Official Symbol
SPRED1
NCBI Official Synonym Symbols
NFLS; hSpred1; spred-1; PPP1R147
NCBI Protein Information
sprouty-related, EVH1 domain-containing protein 1
UniProt Protein Name
Sprouty-related, EVH1 domain-containing protein 1
UniProt Gene Name
SPRED1
UniProt Synonym Gene Names
Spred-1; hSpred1
UniProt Entry Name
SPRE1_HUMAN

Uniprot Description

SPRED1: Tyrosine kinase substrate that inhibits growth-factor- mediated activation of MAP kinase. Negatively regulates hematopoiesis of bone marrow. Defects in SPRED1 are the cause of neurofibromatosis type 1-like syndrome (NFLS). It is a disorder characterized mainly by cafe au lait macules without neurofibromas or other tumor manifestations of neurofibromatosis type 1, axillary freckling, and macrocephaly. Additional clinical manifestations include Noonan-like facial dysmorphism, lipomas, learning disabilities and attention deficit-hyperactivity.

Protein type: Inhibitor

Chromosomal Location of Human Ortholog: 15q14

Cellular Component: cytoplasm; cytosol; nucleoplasm; plasma membrane

Molecular Function: phosphatase binding; protein binding; protein kinase binding; protein serine/threonine kinase inhibitor activity; stem cell factor receptor binding

Biological Process: fibroblast growth factor receptor signaling pathway; inactivation of MAPK activity; MAPKKK cascade; positive regulation of DNA damage response, signal transduction by p53 class mediator

Disease: Legius Syndrome

Similar Products

Product Notes

The SPRED1 spred1 (Catalog #AAA6394993) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SPRED1 (Sprouty-related, EVH1 Domain-containing Protein 1, Spred-1, hSpred1, NFLS) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SPRED1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SPRED1 spred1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SPRED1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.