Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of SPOP expression in transfected 293T cell line by SPOP polyclonal antibody. Lane 1: SPOP transfected lysate (42.1kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human SPOP Polyclonal Antibody | anti-SPOP antibody

SPOP (Speckle-type POZ Protein, BTBD32, HIB Homolog 1, Roadkill Homolog 1, TEF2) (AP)

Gene Names
SPOP; TEF2; BTBD32
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SPOP; Polyclonal Antibody; SPOP (Speckle-type POZ Protein; BTBD32; HIB Homolog 1; Roadkill Homolog 1; TEF2) (AP); anti-SPOP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SPOP.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-SPOP antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human SPOP, aa1-374 (NP_001007227.1).
Immunogen Sequence
MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVKVPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKYALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVAEAYRSLASAQCPFLGPPRKRLKQS
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of SPOP expression in transfected 293T cell line by SPOP polyclonal antibody. Lane 1: SPOP transfected lysate (42.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SPOP expression in transfected 293T cell line by SPOP polyclonal antibody. Lane 1: SPOP transfected lysate (42.1kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-SPOP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42,132 Da
NCBI Official Full Name
speckle-type POZ protein
NCBI Official Synonym Full Names
speckle-type POZ protein
NCBI Official Symbol
SPOP
NCBI Official Synonym Symbols
TEF2; BTBD32
NCBI Protein Information
speckle-type POZ protein; HIB homolog 1; roadkill homolog 1
UniProt Protein Name
Speckle-type POZ protein
Protein Family
UniProt Gene Name
SPOP
UniProt Entry Name
SPOP_HUMAN

NCBI Description

This gene encodes a protein that may modulate the transcriptional repression activities of death-associated protein 6 (DAXX), which interacts with histone deacetylase, core histones, and other histone-associated proteins. In mouse, the encoded protein binds to the putative leucine zipper domain of macroH2A1.2, a variant H2A histone that is enriched on inactivated X chromosomes. The BTB/POZ domain of this protein has been shown in other proteins to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes. Alternative splicing of this gene results in multiple transcript variants encoding the same protein. [provided by RefSeq, Jul 2008]

Uniprot Description

SPOP: Inhibits IPF1/PDX1 transactivation of established target promoters, such as insulin, may be by recruiting a repressor complex. In complex with CUL3, involved in ubiquitination of BMI1, H2AFY and DAXX, and probably also in ubiquitination and proteasomal degradation of Gli2 or Gli3. Belongs to the Tdpoz family.

Chromosomal Location of Human Ortholog: 17q21.33

Cellular Component: nucleoplasm; nuclear speck; nucleus

Molecular Function: protein binding; ubiquitin protein ligase binding

Biological Process: proteasomal ubiquitin-dependent protein catabolic process; protein ubiquitination during ubiquitin-dependent protein catabolic process; glucose homeostasis

Research Articles on SPOP

Similar Products

Product Notes

The SPOP spop (Catalog #AAA6394971) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SPOP (Speckle-type POZ Protein, BTBD32, HIB Homolog 1, Roadkill Homolog 1, TEF2) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SPOP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SPOP spop for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SPOP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.