Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescent analysis of HepG2 cells using MBS7046172 at a dilution of 1:100 and Alexa Fluor 488-congugated AffiniPure Goat Anti-Rabbit IgG(H+L))

Rabbit anti-Human SPNS2 Polyclonal Antibody | anti-SPNS2 antibody

SPNS2 Antibody

Reactivity
Human
Applications
ELISA, Immunofluorescence
Purity
>95%, Protein G purified
Synonyms
SPNS2; Polyclonal Antibody; SPNS2 Antibody; Protein spinster homolog 2; anti-SPNS2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
>95%, Protein G purified
Form/Format
Liquid
Sequence
MMCLECASAAAGGAEEEEADAERRRRRRGAQRGAGGSGCCGARGAGGAGVSAAGDEVQTLSGSVRRAPTGPPGTPGTPGCAATAKGPGAQQPKPASLGRGRGAAAAILSLGNVLNYLDRYTVAGVLLDIQQHFGVKDRGA
Sequence Length
549
Applicable Applications for anti-SPNS2 antibody
ELISA (EIA), Immunofluorescence (IF)
Species
Human
Immunogen
Recombinant human Protein spinster homolog 2 protein
Conjugate
Non-conjugated
Buffer
Preservative: 0.03% Proclin 300
Constituents: 50% Glycerol, 0.01M PBS, PH 7.4
Santa Cruz Alternative
Potential replacement for Santa Cruz Biotechnology antibody catalog# sc-165572 / sc-165574 / sc-130102
Preparation and Storage
Shipped at 4 degree C. Upon delivery aliquot and store at -20 degree C or -80 degree C. Avoid repeated freeze.

Immunofluorescence (IF)

(Immunofluorescent analysis of HepG2 cells using MBS7046172 at a dilution of 1:100 and Alexa Fluor 488-congugated AffiniPure Goat Anti-Rabbit IgG(H+L))

Immunofluorescence (IF) (Immunofluorescent analysis of HepG2 cells using MBS7046172 at a dilution of 1:100 and Alexa Fluor 488-congugated AffiniPure Goat Anti-Rabbit IgG(H+L))
Related Product Information for anti-SPNS2 antibody
Sphingolipid transporter required for migration of myocardial precursors. Transports sphingosine 1-phosphate (S1P), a secreted lipid mediator that plays critical roles in cardiovascular, immunological, and neural development and function. Mediates the export of S1P from cells in the extraembryonic yolk syncytial layer (YSL), thereby regulating myocardial precursor migration.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58,044 Da
NCBI Official Full Name
protein spinster homolog 2
NCBI Official Synonym Full Names
sphingolipid transporter 2
NCBI Official Symbol
SPNS2
NCBI Protein Information
protein spinster homolog 2
UniProt Protein Name
Protein spinster homolog 2
Protein Family
UniProt Gene Name
SPNS2
UniProt Entry Name
SPNS2_HUMAN

NCBI Description

The protein encoded by this gene is a transporter of sphingosine 1-phosphate, a secreted lipid that is important in cardiovascular, immunological, and neural development. Defects in this gene are a cause of early onset progressive hearing loss. [provided by RefSeq, Jul 2016]

Uniprot Description

SPNS2: Sphingolipid transporter required for migration of myocardial precursors. Transports sphingosine 1-phosphate (S1P), a secreted lipid mediator that plays critical roles in cardiovascular, immunological, and neural development and function. Mediates the export of S1P from cells in the extraembryonic yolk syncytial layer (YSL), thereby regulating myocardial precursor migration. Belongs to the major facilitator (TC 2.A.1) superfamily. Spinster (TC 2.A.1.49) family.

Protein type: Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 17p13.2

Cellular Component: lysosomal membrane; vesicle

Molecular Function: sphingolipid transporter activity

Biological Process: locomotion

Research Articles on SPNS2

Similar Products

Product Notes

The SPNS2 spns2 (Catalog #AAA7046172) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SPNS2 Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SPNS2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF). Researchers should empirically determine the suitability of the SPNS2 spns2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MMCLECASAA AGGAEEEEAD AERRRRRRGA QRGAGGSGCC GARGAGGAGV SAAGDEVQTL SGSVRRAPTG PPGTPGTPGC AATAKGPGAQ QPKPASLGRG RGAAAAILSL GNVLNYLDRY TVAGVLLDIQ QHFGVKDRGA. It is sometimes possible for the material contained within the vial of "SPNS2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.