Mouse anti-Human HNRNPA1 Monoclonal Antibody | anti-HNRNPA1 antibody

HNRNPA1 (HNRPA1, Heterogeneous Nuclear Ribonucleoprotein A1, Helix-destabilizing Protein, Single-strand RNA-binding Protein, hnRNP Core Protein A1, MGC102835) APC

Cat. Num. AAA6137010

• Gene Names: HNRNPA1; UP 1; ALS19; ALS20; HNRPA1; IBMPFD3; HNRPA1L3; hnRNP A1; hnRNP-A1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: HNRNPA1; Monoclonal Antibody; HNRNPA1 (HNRPA1; Heterogeneous Nuclear Ribonucleoprotein A1; Helix-destabilizing Protein; Single-strand RNA-binding Protein; hnRNP Core Protein A1; MGC102835) APC; anti-HNRNPA1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2E6
• Specificity: Recognizes human HNRPA1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
• Sequence Length: 1738

• Applicable Applications for anti-HNRNPA1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-320 from human HNRPA1 (AAH33714) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGSFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (60.94kD).)

Western Blot (WB)

(Western Blot analysis of HNRNPA1 expression in transfected 293T cell line by HNRPA1 monoclonal antibody. Lane 1: HNRNPA1 transfected lysate (34.2kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged HNRNPA1 is 0.1ng/ml as a capture antibody.)

Related Product Information for anti-HNRNPA1 antibody

This gene belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind to RNAs. It is one of the most abundant core proteins of hnRNP complexes and it is localized to the nucleoplasm. This protein, along with other hnRNP proteins, is exported from the nucleus, probably bound to mRNA, and is immediately re-imported. Its M9 domain acts as both a nuclear localization and nuclear export signal. The encoded protein is involved in the packaging of pre-mRNA into hnRNP particles, transport of poly A+ mRNA from the nucleus to the cytoplasm, and may modulate splice site selection. It is also thought have a primary role in the formation of specific myometrial protein species in parturition. Multiple alternatively spliced transcript variants have been found for this gene but only two transcripts are fully described. These variants have multiple alternative transcription initiation sites and multiple polyA sites. [provided by RefSeq].

Product Categories/Family for anti-HNRNPA1 antibody

Antibodies; Nuclear Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 21707257
• NCBI GeneID: 3178
• NCBI Official Full Name: Homo sapiens heterogeneous nuclear ribonucleoprotein A1, mRNA
• NCBI Official Synonym Full Names: heterogeneous nuclear ribonucleoprotein A1
• NCBI Official Symbol: HNRNPA1
• NCBI Official Synonym Symbols: UP 1; ALS19; ALS20; HNRPA1; IBMPFD3; HNRPA1L3; hnRNP A1; hnRNP-A1
• NCBI Protein Information: heterogeneous nuclear ribonucleoprotein A1
• Protein Family: Heterogeneous nuclear ribonucleoproteins

NCBI Description

This gene encodes a member of a family of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs), which are RNA-binding proteins that associate with pre-mRNAs in the nucleus and influence pre-mRNA processing, as well as other aspects of mRNA metabolism and transport. The protein encoded by this gene is one of the most abundant core proteins of hnRNP complexes and plays a key role in the regulation of alternative splicing. Mutations in this gene have been observed in individuals with amyotrophic lateral sclerosis 20. Multiple alternatively spliced transcript variants have been found. There are numerous pseudogenes of this gene distributed throughout the genome. [provided by RefSeq, Feb 2016]