Western Blot (WB)
(WB Suggested Anti-SPDYA Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Hela cell lysate)
Rabbit SPDYA Polyclonal Antibody | anti-SPDYA antibody
SPDYA antibody - N-terminal region
Gene Names
SPDYA; SPY1; SPDY1; RINGO3; RINGOA
Reactivity
Cow, Dog, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SPDYA; Polyclonal Antibody; SPDYA antibody - N-terminal region; anti-SPDYA antibody
Host
Rabbit
Reactivity
Cow, Dog, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MRHNQMCCETPPTVTVYVKSGSNRSHQPKKPITLKRPICKDNWQAFEKNT
Sequence Length
313
Applicable Applications for anti-SPDYA antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 100%; Human: 100%; Mouse: 85%; Pig: 100%; Rabbit: 85%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SPDYA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-SPDYA Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Hela cell lysate)
Western Blot (WB)
(WB Suggested Anti-SPDYA Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Hela cell lysate)
Related Product Information for anti-SPDYA antibody
This is a rabbit polyclonal antibody against SPDYA. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: SPDYA regulates the G1/S phase transition of the cell cycle by binding and activating CDC2, CDK2 and CDKN1B/KIP1. SPDYA can activate CDK2 without promoting CDK2 phosphorylation. SPDYA mediates cell survival during the DNA damage process through activation of CDK2.
Target Description: SPDYA regulates the G1/S phase transition of the cell cycle by binding and activating CDC2, CDK2 and CDKN1B/KIP1. SPDYA can activate CDK2 without promoting CDK2 phosphorylation. SPDYA mediates cell survival during the DNA damage process through activation of CDK2.
Product Categories/Family for anti-SPDYA antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
speedy protein A isoform 1
NCBI Official Synonym Full Names
speedy/RINGO cell cycle regulator family member A
NCBI Official Symbol
SPDYA
NCBI Official Synonym Symbols
SPY1; SPDY1; RINGO3; RINGOA
NCBI Protein Information
speedy protein A
UniProt Protein Name
Speedy protein A
Protein Family
UniProt Gene Name
SPDYA
UniProt Synonym Gene Names
RINGO A; hSpy/Ringo A; Spy1
UniProt Entry Name
SPDYA_HUMAN
Uniprot Description
SPDYA: Regulates the G1/S phase transition of the cell cycle by binding and activating CDK1, CDK2 and CDKN1B/KIP1. Can activate CDK2 without promoting CDK2 phosphorylation. Mediates cell survival during the DNA damage process through activation of CDK2. Belongs to the Speedy/Ringo family. 2 isoforms of the human protein are produced by alternative splicing.
Chromosomal Location of Human Ortholog: 2p23.2
Cellular Component: nucleus
Molecular Function: protein kinase binding
Biological Process: positive regulation of cyclin-dependent protein kinase activity; multicellular organismal development; positive regulation of cell proliferation; male meiosis; response to DNA damage stimulus; G1/S transition of mitotic cell cycle
Research Articles on SPDYA
Similar Products
Product Notes
The SPDYA spdya (Catalog #AAA3212433) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SPDYA antibody - N-terminal region reacts with Cow, Dog, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SPDYA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SPDYA spdya for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MRHNQMCCET PPTVTVYVKS GSNRSHQPKK PITLKRPICK DNWQAFEKNT. It is sometimes possible for the material contained within the vial of "SPDYA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
