Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SPAG5Sample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human SPAG5 Polyclonal Antibody | anti-SPAG5 antibody

SPAG5 Antibody - middle region

Gene Names
SPAG5; MAP126; DEEPEST; hMAP126
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
SPAG5; Polyclonal Antibody; SPAG5 Antibody - middle region; anti-SPAG5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EDNLLSSLVILEVLSRQLRDWKSQLAVPHPETQDSSTQTDTSHSGITNKL
Sequence Length
1193
Applicable Applications for anti-SPAG5 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human SPAG5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SPAG5Sample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SPAG5Sample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-SPAG5 antibody
This is a rabbit polyclonal antibody against SPAG5. It was validated on Western Blot

Target Description: This gene encodes a protein associated with the mitotic spindle apparatus. The encoded protein may be involved in the functional and dynamic regulation of mitotic spindles.
Product Categories/Family for anti-SPAG5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
131kDa
NCBI Official Full Name
sperm-associated antigen 5
NCBI Official Synonym Full Names
sperm associated antigen 5
NCBI Official Symbol
SPAG5
NCBI Official Synonym Symbols
MAP126; DEEPEST; hMAP126
NCBI Protein Information
sperm-associated antigen 5
UniProt Protein Name
Sperm-associated antigen 5
Protein Family
UniProt Gene Name
SPAG5
UniProt Synonym Gene Names
MAP126
UniProt Entry Name
SPAG5_HUMAN

NCBI Description

This gene encodes a protein associated with the mitotic spindle apparatus. The encoded protein may be involved in the functional and dynamic regulation of mitotic spindles. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: Essential component of the mitotic spindle required for normal chromosome segregation and progression into anaphase. Required for chromosome alignment, normal timing of sister chromatid segregation, and maintenance of spindle pole architecture. The astrin (SPAG5)-kinastrin (SKAP) complex promotes stable microtubule-kinetochore attachments. Ref.1 Ref.6 Ref.15

Subunit structure: Homodimer, with a globular head domain and a long stalk. Homooligomer; the globular head domains associate, resulting in aster-like structures. Binds to microtubules in the mitotic spindle. Interacts with DCLRE1B/Apollo. Part of an astrin (SPAG5)-kinastrin (SKAP) complex containing KNSTRN, SPAG5, PLK1, DYNLL1 and SGOL2. Interacts with KNSTRN. Ref.1 Ref.6 Ref.11 Ref.15

Subcellular location: Cytoplasm. Cytoplasm › cytoskeleton › spindle. Cytoplasm › cytoskeleton › spindle pole. Chromosome › centromere › kinetochore. Note: In a punctate pattern in interphase cells. During mitosis, detected at spindle poles during prophase, throughout the spindle in metaphase and anaphase, and at midzone microtubules in anaphase and telophase. Detected on kinetochores of chromosomes that have congressed. The astrin (SPAG5)-kinastrin (SKAP) complex localizes to the microtubule plus ends

By similarity. Ref.1 Ref.2 Ref.6 Ref.15

Tissue specificity: Highly expressed in testis. Detected at low levels in placenta, liver, pancreas, thymus and colon. Ref.2

Sequence caution: The sequence AAD02813.1 differs from that shown. Reason: Frameshift at position 1093. The sequence AAL06396.2 differs from that shown. Reason: Frameshift at position 1135.

Research Articles on SPAG5

Similar Products

Product Notes

The SPAG5 spag5 (Catalog #AAA3220000) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SPAG5 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SPAG5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SPAG5 spag5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EDNLLSSLVI LEVLSRQLRD WKSQLAVPHP ETQDSSTQTD TSHSGITNKL. It is sometimes possible for the material contained within the vial of "SPAG5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.