Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-SP4 Polyclonal Antibody)

Rabbit SP4 Polyclonal Antibody | anti-SP4 antibody

SP4 Polyclonal Antibody

Gene Names
SP4; HF1B; SPR-1
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purification
Synonyms
SP4; Polyclonal Antibody; SP4 Polyclonal Antibody; HF1B; SPR-1; transcription factor Sp4; anti-SP4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
2.5 mg/ml (varies by lot)
Sequence Length
784
Applicable Applications for anti-SP4 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
WB: 1:500-1:2000
IHC: 1:100-1:200
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 280-440 of human SP4 (NP_003103.2).
Immunogen Sequence
TGQVGQPAATADSGTSNGNQLVSTPTNTTTSASTMPESPSSSTTCTTTASTSLTSSDTLVSSADTGQYASTSASSSERTIEESQTPAATESEAQSSSQLQPNGMQNAQDQSNSLQQVQIVGQPILQQIQIQQPQQQIIQAIPPQSFQLQSGQTIQTIQQQP
Positive Samples
Mouse Thymus, Mouse Spleen, Mouse Pancreas, Rat Thymus
Cellular Location
Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-SP4 Polyclonal Antibody)

Western Blot (WB) (Western blot-SP4 Polyclonal Antibody)
Related Product Information for anti-SP4 antibody
The protein encoded by this gene is a transcription factor that can bind to the GC promoter region of a variety of genes, including those of the photoreceptor signal transduction system. The encoded protein binds to the same sites in promoter CpG islands as does the transcription factor SP1, although its expression is much more restricted compared to that of SP1. This gene may be involved in bipolar disorder and schizophrenia.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
Calculated: 81kDa
Observed: 82kDa
NCBI Official Full Name
Transcription factor Sp4
NCBI Official Synonym Full Names
Sp4 transcription factor
NCBI Official Symbol
SP4
NCBI Official Synonym Symbols
HF1B; SPR-1
NCBI Protein Information
transcription factor Sp4
UniProt Protein Name
Transcription factor Sp4
Protein Family
UniProt Gene Name
SP4
UniProt Entry Name
SP4_HUMAN

NCBI Description

The protein encoded by this gene is a transcription factor that can bind to the GC promoter region of a variety of genes, including those of the photoreceptor signal transduction system. The encoded protein binds to the same sites in promoter CpG islands as does the transcription factor SP1, although its expression is much more restricted compared to that of SP1. This gene may be involved in bipolar disorder and schizophrenia. [provided by RefSeq, May 2016]

Uniprot Description

SP4: Binds to GT and GC boxes promoters elements. Probable transcriptional activator. Belongs to the Sp1 C2H2-type zinc-finger protein family.

Protein type: Transcription factor; DNA-binding; C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 7p15.3

Cellular Component: microtubule cytoskeleton; nucleoplasm; intercellular bridge; cytoplasm

Molecular Function: DNA binding; metal ion binding; transcription coactivator activity

Biological Process: transcription from RNA polymerase II promoter; regulation of transcription from RNA polymerase II promoter; regulation of heart contraction

Research Articles on SP4

Similar Products

Product Notes

The SP4 sp4 (Catalog #AAA9140844) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SP4 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SP4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). WB: 1:500-1:2000 IHC: 1:100-1:200. Researchers should empirically determine the suitability of the SP4 sp4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SP4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.