Mouse anti-Human SGMS2 Monoclonal Antibody | anti-SGMS2 antibody

SGMS2 (SMS2, Phosphatidylcholine:ceramide Cholinephosphotransferase 2, Sphingomyelin Synthase 2, MGC26963) (Biotin)

Cat. Num. AAA6144325

• Gene Names: SGMS2; SMS2
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SGMS2; Monoclonal Antibody; SGMS2 (SMS2; Phosphatidylcholine:ceramide Cholinephosphotransferase 2; Sphingomyelin Synthase 2; MGC26963) (Biotin); anti-SGMS2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 7D10
• Specificity: Recognizes human MGC26963.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-SGMS2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant protein corresponding to aa2-81 from human MGC26963 (NP_689834) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: DIIETAKLEEHLENQPSDPTNTYARPAEPVEEENKNGNGKPKSLSSGLRKGTKKYPDYIQIAMPTESRNKFPLEWWKTG
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.8kD).)

Western Blot (WB)

(Western Blot analysis of MGC26963 expression in transfected 293T cell line by MGC26963 monoclonal antibody. Lane 1: MGC26963 transfected lysate (42.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB)

(Western blot analysis of MGC26963 over-expressed 293 cell line, cotransfected with MGC26963 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with MGC26963 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Related Product Information for anti-SGMS2 antibody

Sphingomyelin, a major component of cell and Golgi membranes, is made by the transfer of phosphocholine from phosphatidylcholine onto ceramide, with diacylglycerol as a side product. The protein encoded by this gene is an enzyme that catalyzes this reaction primarily at the cell membrane. The synthesis is reversible, and this enzyme can catalyze the reaction in either direction. The encoded protein is required for cell growth. Three transcript variants encoding the same protein have been found for this gene.

Product Categories/Family for anti-SGMS2 antibody

Antibodies; Enzymes; Synthase

NCBI and Uniprot Product Information

• NCBI GI #: 22749271
• NCBI GeneID: 166929
• NCBI Accession #: NP_689834
• NCBI GenBank Nucleotide #: NM_152621
• UniProt Accession #: Q8NHU3
• Molecular Weight: 42kDa
• NCBI Official Full Name: phosphatidylcholine:ceramide cholinephosphotransferase 2
• NCBI Official Synonym Full Names: sphingomyelin synthase 2
• NCBI Official Symbol: SGMS2
• NCBI Official Synonym Symbols: SMS2
• NCBI Protein Information: phosphatidylcholine:ceramide cholinephosphotransferase 2
• UniProt Protein Name: Phosphatidylcholine:ceramide cholinephosphotransferase 2
• UniProt Gene Name: SGMS2
• UniProt Synonym Gene Names: SMS2
• UniProt Entry Name: SMS2_HUMAN

NCBI Description

Sphingomyelin, a major component of cell and Golgi membranes, is made by the transfer of phosphocholine from phosphatidylcholine onto ceramide, with diacylglycerol as a side product. The protein encoded by this gene is an enzyme that catalyzes this reaction primarily at the cell membrane. The synthesis is reversible, and this enzyme can catalyze the reaction in either direction. The encoded protein is required for cell growth. Three transcript variants encoding the same protein have been found for this gene. There is evidence for more variants, but the full-length nature of their transcripts has not been determined.[provided by RefSeq, Oct 2008]

Uniprot Description

SMS2: Sphingomyelin synthases synthesize the sphingolipid, sphingomyelin, through transfer of the phosphatidyl head group, phosphatidylcholine, on to the primary hydroxyl of ceramide. The reaction is bidirectional depending on the respective levels of the sphingolipid and ceramide. Plasma membrane SMS2 can also convert phosphatidylethanolamine (PE) to ceramide phosphatidylethanolamine (CPE). Major form in liver. Required for cell growth in certain cell types. Regulator of cell surface levels of ceramide, an important mediator of signal transduction and apoptosis. Regulation of sphingomyelin (SM) levels at the cell surface affects insulin sensitivity. Belongs to the sphingomyelin synthase family.

Protein type: Lipid Metabolism - sphingolipid; Transferase; Membrane protein, integral; Membrane protein, multi-pass; EC 2.7.8.27

Chromosomal Location of Human Ortholog: 4q25

Cellular Component: Golgi apparatus; integral to plasma membrane; plasma membrane; integral to Golgi membrane

Molecular Function: sphingomyelin synthase activity; kinase activity; ceramide cholinephosphotransferase activity

Biological Process: sphingolipid metabolic process; sphingolipid biosynthetic process; sphingomyelin biosynthetic process; phosphorylation