Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti- SOX5 Picoband antibody, MBS177856, Western blottingAll lanes: Anti SOX5 (MBS177856) at 0.5ug/mlLane 1: Rat Liver Tissue Lysate at 50ugLane 2: Rat Testis Tissue Lysate at 50ugLane 3: Rat Brain Tissue Lysate at 50ugLane 4: HELA Whole Cell Lysate at 40ugLane 5: A549 Whole Cell Lysate at 40ugPredicted bind size: 84KDObserved bind size: 84KD )

anti-Human, Rat SOX5 Polyclonal Antibody | anti-SOX5 antibody

Anti-SOX5 Antibody

Gene Names
SOX5; L-SOX5; LAMSHF; L-SOX5B; L-SOX5F
Reactivity
Human, Rat
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
SOX5; Polyclonal Antibody; Anti-SOX5 Antibody; Transcription factor SOX-5; L SOX5; MGC35153; Sex determining region Y box 5; SOX 5; SOX 5 protein; Sox5; SOX5 protein; SOX5_HUMAN; SRY (sex determining region Y) box 5; SRY box 5; Transcription factor SOX 5; Transcription factor SOX5; SRY (sex determining region Y)-box 5; anti-SOX5 antibody
Ordering
For Research Use Only!
Reactivity
Human, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
642
Applicable Applications for anti-SOX5 antibody
Western Blot (WB)
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human SOX5 (495-528aa EKEKTTLESLTQQLAVKQNEEGKFSHAMMDFNLS), different from the related mouse sequence by two amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- SOX5 Picoband antibody, MBS177856, Western blottingAll lanes: Anti SOX5 (MBS177856) at 0.5ug/mlLane 1: Rat Liver Tissue Lysate at 50ugLane 2: Rat Testis Tissue Lysate at 50ugLane 3: Rat Brain Tissue Lysate at 50ugLane 4: HELA Whole Cell Lysate at 40ugLane 5: A549 Whole Cell Lysate at 40ugPredicted bind size: 84KDObserved bind size: 84KD )

Western Blot (WB) (Anti- SOX5 Picoband antibody, MBS177856, Western blottingAll lanes: Anti SOX5 (MBS177856) at 0.5ug/mlLane 1: Rat Liver Tissue Lysate at 50ugLane 2: Rat Testis Tissue Lysate at 50ugLane 3: Rat Brain Tissue Lysate at 50ugLane 4: HELA Whole Cell Lysate at 40ugLane 5: A549 Whole Cell Lysate at 40ugPredicted bind size: 84KDObserved bind size: 84KD )

Western Blot (WB)

(Figure 2. Western blot analysis of SOX5 using anti-SOX5 antibody (MBS177856).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 40ug of sample under reducing conditions.All lanes: pig adipose cellsAfter Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-SOX5 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for SOX5 at approximately 84KD. The expected band size for SOX5 is at 84KD. )

Western Blot (WB) (Figure 2. Western blot analysis of SOX5 using anti-SOX5 antibody (MBS177856).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 40ug of sample under reducing conditions.All lanes: pig adipose cellsAfter Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-SOX5 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for SOX5 at approximately 84KD. The expected band size for SOX5 is at 84KD. )
Related Product Information for anti-SOX5 antibody
Description: Rabbit IgG polyclonal antibody for Transcription factor SOX-5(SOX5) detection. Tested with WB in Human;Rat.

Background: Transcription factor SOX-5 is a protein that in humans is encoded by the SOX5 gene. It is located on 12p12.1. This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. In addition, the encoded protein may play a role in chondrogenesis. A pseudogene of this gene is located on chromosome 8. Multiple transcript variants encoding distinct isoforms have been identified for this gene.
References
1. "Entrez Gene: SOX5 SRY (sex determining region Y)-box 5". 2. Ikeda T; Zhang J; Chano T et al. (2003). "Identification and characterization of the human long form of Sox5 (L-SOX5) gene". Gene 298 (1): 59-68. 3. Wunderle VM, Critcher R, Ashworth A, Goodfellow PN (Jan 1997). "Cloning and characterization of SOX5, a new member of the human SOX gene family". Genomics 36 (2): 354-8.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
82,770 Da
NCBI Official Full Name
transcription factor SOX-5 isoform d
NCBI Official Synonym Full Names
SRY-box 5
NCBI Official Symbol
SOX5
NCBI Official Synonym Symbols
L-SOX5; LAMSHF; L-SOX5B; L-SOX5F
NCBI Protein Information
transcription factor SOX-5
UniProt Protein Name
Transcription factor SOX-5
Protein Family
UniProt Gene Name
SOX5
UniProt Entry Name
SOX5_HUMAN

NCBI Description

This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The encoded protein may play a role in chondrogenesis. A pseudogene of this gene is located on chromosome 8. Multiple transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

SOX5: Binds specifically to the DNA sequence 5'-AACAAT-3'. Activates transcription of COL2A1 and AGC1 in vitro. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 12p12.1

Cellular Component: nucleus

Molecular Function: DNA binding; protein binding; transcription factor activity

Biological Process: asymmetric neuroblast division; positive regulation of chondrocyte differentiation; regulation of transcription, DNA-dependent; transcription from RNA polymerase II promoter

Research Articles on SOX5

Similar Products

Product Notes

The SOX5 sox5 (Catalog #AAA177856) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-SOX5 Antibody reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SOX5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot Concentration: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the SOX5 sox5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SOX5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.