Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using SOX18 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)

Rabbit anti-Mouse, Rat SOX18 Polyclonal Antibody | anti-SOX18 antibody

SOX18 Rabbit pAb

Gene Names
SOX18; HLTS
Reactivity
Mouse, Rat
Applications
Western Blot
Purity
Affinity purification
Synonyms
SOX18; Polyclonal Antibody; SOX18 Rabbit pAb; HLTRS; HLTS; anti-SOX18 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MQRSPPGYGAQDDPPARRDCAWAPGHGAAADTRGLAAGPAALAAPAAPASPPSPQRSPPRSPEPGRYGLSPAGRGERQAADESRIRRPMNAFMVWAKDER
Applicable Applications for anti-SOX18 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SOX18 (NP_060889.1).
Cellular Location
Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using SOX18 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using SOX18 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)
Related Product Information for anti-SOX18 antibody
Background: This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. This protein plays a role in hair, blood vessel, and lymphatic vessel development. Mutations in this gene have been associated with recessive and dominant forms of hypotrichosis-lymphedema-telangiectasia.
Product Categories/Family for anti-SOX18 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Predicted: 42 kDa

Observed: 44 kDa
NCBI Official Full Name
transcription factor SOX-18
NCBI Official Synonym Full Names
SRY (sex determining region Y)-box 18
NCBI Official Symbol
SOX18
NCBI Official Synonym Symbols
HLTS
NCBI Protein Information
transcription factor SOX-18; SRY-box 18
UniProt Protein Name
Transcription factor SOX-18
Protein Family
UniProt Gene Name
SOX18
UniProt Entry Name
SOX18_HUMAN

NCBI Description

This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. This protein plays a role in hair, blood vessel, and lymphatic vessel development. Mutations in this gene have been associated with recessive and dominant forms of hypotrichosis-lymphedema-telangiectasia. [provided by RefSeq, Jul 2008]

Uniprot Description

SOX18: Binds to the consensus sequence 5'-AACAAAG-3' and is able to trans-activate transcription via this site. Defects in SOX18 are the cause of hypotrichosis- lymphedema-telangiectasia syndrome (HLTS).

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 20q13.33

Cellular Component: nuclear chromatin; nucleus

Molecular Function: protein heterodimerization activity

Biological Process: blood vessel endothelial cell migration; in utero embryonic development; positive regulation of transcription, DNA-dependent; cell maturation; stem cell fate specification; negative regulation of transcription from RNA polymerase II promoter; mRNA transcription from RNA polymerase II promoter; hair cycle process; hair follicle development; vasculature development; lymphangiogenesis; embryonic heart tube development; positive regulation of transcription from RNA polymerase II promoter; heart looping; angiogenesis; vasculogenesis; negative regulation of transcription, DNA-dependent

Disease: Hypotrichosis-lymphedema-telangiectasia Syndrome; Hypotrichosis-lymphedema-telangiectasia-renal Defect Syndrome

Research Articles on SOX18

Similar Products

Product Notes

The SOX18 sox18 (Catalog #AAA9142351) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SOX18 Rabbit pAb reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SOX18 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the SOX18 sox18 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MQRSPPGYGA QDDPPARRDC AWAPGHGAAA DTRGLAAGPA ALAAPAAPAS PPSPQRSPPR SPEPGRYGLS PAGRGERQAA DESRIRRPMN AFMVWAKDER. It is sometimes possible for the material contained within the vial of "SOX18, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.