Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.09kD).)

Mouse SFRS3 Monoclonal Antibody | anti-SFRS3 antibody

SFRS3 (Serine/Arginine-rich Splicing Factor 3, Pre-mRNA-splicing Factor SRP20, Splicing Factor, Arginine/Serine-rich 3, SRP20) (AP)

Gene Names
SRSF3; SFRS3; SRp20
Reactivity
Human, Mouse, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SFRS3; Monoclonal Antibody; SFRS3 (Serine/Arginine-rich Splicing Factor 3; Pre-mRNA-splicing Factor SRP20; Splicing Factor; Arginine/Serine-rich 3; SRP20) (AP); anti-SFRS3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2D2
Specificity
Recognizes human SFRS3. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-SFRS3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-86, from SFRS3 (NP_003008) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EEKISDSEGFKANLSLLRRPGEKTYTQRCRLFVGNLPADITEDEFKRLFAKYGEPGEVFINKGKGFGFIKLESRALAEIAKAELDDTPMRGRQ*
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.09kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.09kD).)

Western Blot (WB)

(SFRS3 monoclonal antibody. Western Blot analysis of SFRS3 expression in Raw 264.7)

Western Blot (WB) (SFRS3 monoclonal antibody. Western Blot analysis of SFRS3 expression in Raw 264.7)

Western Blot (WB)

(SFRS3 monoclonal antibody. Western Blot analysis of SFRS3 expression in NIH/3T3)

Western Blot (WB) (SFRS3 monoclonal antibody. Western Blot analysis of SFRS3 expression in NIH/3T3)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SFRS3 on HeLa cell. [antibody concentration 10ug/ml)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to SFRS3 on HeLa cell. [antibody concentration 10ug/ml)

Testing Data

(Detection limit for recombinant GST tagged SFRS3 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SFRS3 is ~0.1ng/ml as a capture antibody.)
Related Product Information for anti-SFRS3 antibody
SFRS3 is a member of the serine/arginine (SR)-rich family of pre-mRNA splicing factors, which constitute part of the spliceosome. Each of these factors contains an RNA recognition motif (RRM) for binding RNA and an RS domain for binding other proteins. The RS domain is rich in serine and arginine residues and facilitates interaction between different SR splicing factors. In addition to being critical for mRNA splicing, the SR proteins have also been shown to be involved in mRNA export from the nucleus and in translation. Two transcript variants, one protein-coding and the other non-coding, have been found for this gene.
Product Categories/Family for anti-SFRS3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Predicted: 18 kDa

Observed: 19 kDa
NCBI Official Full Name
serine/arginine-rich splicing factor 3
NCBI Official Synonym Full Names
serine/arginine-rich splicing factor 3
NCBI Official Symbol
SRSF3
NCBI Official Synonym Symbols
SFRS3; SRp20
NCBI Protein Information
serine/arginine-rich splicing factor 3; pre-mRNA-splicing factor SRP20; splicing factor, arginine/serine-rich 3; splicing factor, arginine/serine-rich, 20-kD
UniProt Protein Name
Serine/arginine-rich splicing factor 3
UniProt Gene Name
SRSF3
UniProt Synonym Gene Names
SFRS3; SRP20
UniProt Entry Name
SRSF3_HUMAN

NCBI Description

The protein encoded by this gene is a member of the serine/arginine (SR)-rich family of pre-mRNA splicing factors, which constitute part of the spliceosome. Each of these factors contains an RNA recognition motif (RRM) for binding RNA and an RS domain for binding other proteins. The RS domain is rich in serine and arginine residues and facilitates interaction between different SR splicing factors. In addition to being critical for mRNA splicing, the SR proteins have also been shown to be involved in mRNA export from the nucleus and in translation. Two transcript variants, one protein-coding and the other non-coding, have been found for this gene. [provided by RefSeq, Sep 2010]

Uniprot Description

SFRS3: May be involved in RNA processing in relation with cellular proliferation and/or maturation. Belongs to the splicing factor SR family.

Protein type: Spliceosome; RNA-binding; RNA processing; RNA splicing

Chromosomal Location of Human Ortholog: 6p21

Cellular Component: nucleoplasm; cytoplasm

Molecular Function: protein binding; RNA binding; nucleotide binding

Biological Process: nuclear mRNA splicing, via spliceosome; transcription from RNA polymerase II promoter; mRNA export from nucleus; RNA splicing; gene expression; mRNA 3'-end processing; termination of RNA polymerase II transcription

Research Articles on SFRS3

Similar Products

Product Notes

The SFRS3 srsf3 (Catalog #AAA6133709) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SFRS3 (Serine/Arginine-rich Splicing Factor 3, Pre-mRNA-splicing Factor SRP20, Splicing Factor, Arginine/Serine-rich 3, SRP20) (AP) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SFRS3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SFRS3 srsf3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SFRS3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.