Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SOCS4Sample Tissue: Human HepG2 Whole CellAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human SOCS4 Polyclonal Antibody | anti-SOCS4 antibody

SOCS4 Antibody - N-terminal region

Gene Names
SOCS4; SOCS7
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
SOCS4; Polyclonal Antibody; SOCS4 Antibody - N-terminal region; anti-SOCS4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DVRPKTSRSRSADRKDGYVWSGKKLSWSKKSESYSDAETVNGIEKTEVSL
Sequence Length
440
Applicable Applications for anti-SOCS4 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SOCS4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SOCS4Sample Tissue: Human HepG2 Whole CellAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SOCS4Sample Tissue: Human HepG2 Whole CellAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-SOCS4 antibody
The protein encoded by this gene contains a SH2 domain and a SOCS BOX domain. The protein thus belongs to the suppressor of cytokine signaling (SOCS), also known as STAT-induced STAT inhibitor (SSI), protein family. SOCS family members are known to be cytokine-inducible negative regulators of cytokine signaling. Two alternatively spliced transcript variants encoding the same protein have been found for this gene.
Product Categories/Family for anti-SOCS4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51 kDa
NCBI Official Full Name
suppressor of cytokine signaling 4
NCBI Official Synonym Full Names
suppressor of cytokine signaling 4
NCBI Official Symbol
SOCS4
NCBI Official Synonym Symbols
SOCS7
NCBI Protein Information
suppressor of cytokine signaling 4
UniProt Protein Name
Suppressor of cytokine signaling 4
UniProt Gene Name
SOCS4
UniProt Synonym Gene Names
SOCS7; SOCS-4; SOCS-7
UniProt Entry Name
SOCS4_HUMAN

NCBI Description

The protein encoded by this gene contains a SH2 domain and a SOCS BOX domain. The protein thus belongs to the suppressor of cytokine signaling (SOCS), also known as STAT-induced STAT inhibitor (SSI), protein family. SOCS family members are known to be cytokine-inducible negative regulators of cytokine signaling. Two alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

SOCS4: SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. May be a substrate-recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Inhibits for instance EGF signaling by mediating the degradation of the EGF receptor/EGFR.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 14q22.1

Cellular Component: cytoplasm

Molecular Function: protein binding; protein kinase inhibitor activity

Biological Process: cytokine and chemokine mediated signaling pathway; negative regulation of epidermal growth factor receptor activity; negative regulation of JAK-STAT cascade; positive regulation of proteasomal ubiquitin-dependent protein catabolic process; protein ubiquitination; regulation of growth

Research Articles on SOCS4

Similar Products

Product Notes

The SOCS4 socs4 (Catalog #AAA3220878) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SOCS4 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SOCS4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SOCS4 socs4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DVRPKTSRSR SADRKDGYVW SGKKLSWSKK SESYSDAETV NGIEKTEVSL. It is sometimes possible for the material contained within the vial of "SOCS4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.