Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (SNX11 rabbit polyclonal antibody. Western Blot analysis of SNX11 expression in human liver.)

Rabbit anti-Human, Mouse SNX11 Polyclonal Antibody | anti-SNX11 antibody

SNX11 (Sorting Nexin-11)

Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
SNX11; Polyclonal Antibody; SNX11 (Sorting Nexin-11); Anti -SNX11 (Sorting Nexin-11); anti-SNX11 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SNX11. Species Crossreactivity: mouse.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MGFWCRMSENQEQEEVITVRVQDPRVQNEGSWNSYVDYKIFLHTNSKAFTAKTSCVRRRYREFVWLRKQLQRNAGLVPVPELPGKSTFFGTSDEFIEKRRQGLQHFLEKVLQSVVLLSDSQLHLFLQSQLSVPEIEACVQGRSTMTVSDAILRYAMSNCGWAQEERQSSSHLAKGDQPKSCCFLPRSGRRSSPSPPPSEEKDHLEVWAPVVDSEVPSLESPTLPPLSSPLCCDFGRPKEGTSTLQSVRRAVGGDHAVPLDPGQLETVLEK*
Applicable Applications for anti-SNX11 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human SNX11, aa1-271 (AAH00768).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(SNX11 rabbit polyclonal antibody. Western Blot analysis of SNX11 expression in human liver.)

Western Blot (WB) (SNX11 rabbit polyclonal antibody. Western Blot analysis of SNX11 expression in human liver.)

Western Blot (WB)

(SNX11 rabbit polyclonal antibody. Western Blot analysis of SNX11 expression in mouse liver.)

Western Blot (WB) (SNX11 rabbit polyclonal antibody. Western Blot analysis of SNX11 expression in mouse liver.)

Western Blot (WB)

(SNX11 rabbit polyclonal antibody. Western Blot analysis of SNX11 expression in HepG2.)

Western Blot (WB) (SNX11 rabbit polyclonal antibody. Western Blot analysis of SNX11 expression in HepG2.)

Western Blot (WB)

(Western Blot analysis of SNX11 expression in transfected 293T cell line by SNX11 polyclonal antibody. Lane 1: SNX11 transfected lysate (29.81kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SNX11 expression in transfected 293T cell line by SNX11 polyclonal antibody. Lane 1: SNX11 transfected lysate (29.81kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-SNX11 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30,433 Da
NCBI Official Full Name
sorting nexin-11
NCBI Official Synonym Full Names
sorting nexin 11
NCBI Official Symbol
SNX11
NCBI Protein Information
sorting nexin-11
UniProt Protein Name
Sorting nexin-11
Protein Family
UniProt Gene Name
SNX11
UniProt Entry Name
SNX11_HUMAN

NCBI Description

This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region, like some family members. This gene encodes a protein of unknown function. This gene results in two transcript variants differing in the 5' UTR, but encoding the same protein. [provided by RefSeq, Jul 2008]

Uniprot Description

SNX11: May be involved in several stages of intracellular trafficking. Belongs to the sorting nexin family.

Protein type: Lipid-binding

Chromosomal Location of Human Ortholog: 17q21.32

Cellular Component: extrinsic to membrane; endosome

Biological Process: intracellular protein transport; vesicle organization and biogenesis; endocytosis

Research Articles on SNX11

Similar Products

Product Notes

The SNX11 snx11 (Catalog #AAA6004163) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SNX11 (Sorting Nexin-11) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's SNX11 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the SNX11 snx11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGFWCRMSEN QEQEEVITVR VQDPRVQNEG SWNSYVDYKI FLHTNSKAFT AKTSCVRRRY REFVWLRKQL QRNAGLVPVP ELPGKSTFFG TSDEFIEKRR QGLQHFLEKV LQSVVLLSDS QLHLFLQSQL SVPEIEACVQ GRSTMTVSDA ILRYAMSNCG WAQEERQSSS HLAKGDQPKS CCFLPRSGRR SSPSPPPSEE KDHLEVWAPV VDSEVPSLES PTLPPLSSPL CCDFGRPKEG TSTLQSVRRA VGGDHAVPLD PGQLETVLEK *. It is sometimes possible for the material contained within the vial of "SNX11, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.