Mouse anti-Human SNX11 Polyclonal Antibody | anti-SNX11 antibody

SNX11 (Sorting Nexin-11)

Cat. Num. AAA649062

• Reactivity: Human
• Applications: Western Blot, Immunofluorescence
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: SNX11; Polyclonal Antibody; SNX11 (Sorting Nexin-11); Anti -SNX11 (Sorting Nexin-11); anti-SNX11 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human SNX11.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MGFWCRMSENQEQEEVITVRVQDPRVQNEGSWNSYVDYKIFLHTNSKAFTAKTSCVRRRYREFVWLRKQLQRNAGLVPVPELPGKSTFFGTSDEFIEKRRQGLQHFLEKVLQSVVLLSDSQLHLFLQSQLSVPEIEACVQGRSTMTVSDAILRYAMSNCGWAQEERQSSSHLAKGDQPKSCCFLPRSGRRSSPSPPPSEEKDHLEVWAPVVDSEVPSLESPTLPPLSSPLCCDFGRPKEGTSTLQSVRRAVGGDHAVPLDPGQLETVLEK

• Applicable Applications for anti-SNX11 antibody: Western Blot (WB), Immunofluorescence (IF)
• Application Notes: Suitable for use in Western Blot and Immunofluorescence.; Dilution: Immunofluorescence: 10ug/ml
• Immunogen: Full length human SNX11, aa1-270 (NP_037455.2).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of SNX11 expression in transfected 293T cell line by SNX11 polyclonal antibody. Lane 1: SNX11 transfected lysate (29.7kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of purified antibody to SNX11 on HeLa cell. [antibody concentration 10ug/ml].)

Product Categories/Family for anti-SNX11 antibody

Antibodies; Abs to SNX Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 23111028
• NCBI GeneID: 29916
• NCBI Accession #: NP_689450.1
• NCBI GenBank Nucleotide #: NM_152244.1
• UniProt Accession #: Q9Y5W9; Q53YC0; Q9H885; B3KRL6; D3DTV0
• Molecular Weight: 30,433 Da
• NCBI Official Full Name: sorting nexin-11
• NCBI Official Synonym Full Names: sorting nexin 11
• NCBI Official Symbol: SNX11
• NCBI Protein Information: sorting nexin-11
• UniProt Protein Name: Sorting nexin-11
• Protein Family: Sorting nexin
• UniProt Gene Name: SNX11
• UniProt Entry Name: SNX11_HUMAN

NCBI Description

This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region, like some family members. This gene encodes a protein of unknown function. This gene results in two transcript variants differing in the 5' UTR, but encoding the same protein. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: Phosphoinositide-binding protein involved in protein sorting and membrane trafficking in endosomes. Ref.6

Subunit structure: Monomer. Ref.6

Subcellular location: Membrane; Peripheral membrane protein; Cytoplasmic side

Potential. Endosome Ref.6.

Domain: The PX domain mediates interaction with membranes enriched in phosphatidylinositol 3-phosphate (Ref.6).

Sequence similarities: Belongs to the sorting nexin family.Contains 1 PX (phox homology) domain.

Sequence caution: The sequence AAD27834.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.