Western Blot (WB)
(WB Suggested Anti-SNTG1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: HepG2 cell lysate)
Rabbit SNTG1 Polyclonal Antibody | anti-SNTG1 antibody
SNTG1 antibody - middle region
Gene Names
SNTG1; SYN4; G1SYN
Reactivity
Cow, Dog, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SNTG1; Polyclonal Antibody; SNTG1 antibody - middle region; anti-SNTG1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RFSQYVPGTDLSRQNAFQVIAVDGVCTGIIQCLSAEDCVDWLQAIATNIS
Sequence Length
517
Applicable Applications for anti-SNTG1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SNTG1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-SNTG1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: HepG2 cell lysate)
Western Blot (WB)
(WB Suggested Anti-SNTG1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: HepG2 cell lysate)
Related Product Information for anti-SNTG1 antibody
This is a rabbit polyclonal antibody against SNTG1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The protein encoded by this gene is a member of the syntrophin family. Syntrophins are cytoplasmic peripheral membrane proteins that typically contain 2 pleckstrin homology (PH) domains, a PDZ domain that bisects the first PH domain, and a C-terminal doma
Target Description: The protein encoded by this gene is a member of the syntrophin family. Syntrophins are cytoplasmic peripheral membrane proteins that typically contain 2 pleckstrin homology (PH) domains, a PDZ domain that bisects the first PH domain, and a C-terminal doma
Product Categories/Family for anti-SNTG1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58kDa
NCBI Official Full Name
gamma-1-syntrophin isoform 1
NCBI Official Synonym Full Names
syntrophin gamma 1
NCBI Official Symbol
SNTG1
NCBI Official Synonym Symbols
SYN4; G1SYN
NCBI Protein Information
gamma-1-syntrophin
UniProt Protein Name
Gamma-1-syntrophin
Protein Family
UniProt Gene Name
SNTG1
UniProt Entry Name
SNTG1_HUMAN
NCBI Description
The protein encoded by this gene is a member of the syntrophin family. Syntrophins are cytoplasmic peripheral membrane proteins that typically contain 2 pleckstrin homology (PH) domains, a PDZ domain that bisects the first PH domain, and a C-terminal domain that mediates dystrophin binding. This family member plays a role in mediating gamma-enolase trafficking to the plasma membrane and in enhancing its neurotrophic activity. Mutations in this gene are associated with idiopathic scoliosis. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Mar 2016]
Research Articles on SNTG1
Similar Products
Product Notes
The SNTG1 sntg1 (Catalog #AAA3213285) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SNTG1 antibody - middle region reacts with Cow, Dog, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SNTG1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SNTG1 sntg1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RFSQYVPGTD LSRQNAFQVI AVDGVCTGII QCLSAEDCVD WLQAIATNIS. It is sometimes possible for the material contained within the vial of "SNTG1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
