Mouse anti-Human SNRPA1 Polyclonal Antibody | anti-SNRPA1 antibody

SNRPA1 (U2 Small Nuclear Ribonucleoprotein A', U2 snRNP A')

Cat. Num. AAA649278

• Gene Names: SNRPA1; Lea1
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: SNRPA1; Polyclonal Antibody; SNRPA1 (U2 Small Nuclear Ribonucleoprotein A'; U2 snRNP A'); Anti -SNRPA1 (U2 Small Nuclear Ribonucleoprotein A'; anti-SNRPA1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human SNRPA1.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERLKGLLQSGQIPGRERRSGPTDDGEEEMEEDTVTNGS

• Applicable Applications for anti-SNRPA1 antibody: Western Blot (WB)
• Application Notes: Suitable for use in Western Blot.
• Immunogen: Full length human SNRPA1, aa1-255 (NP_003081).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(SNRPA1 polyclonal antibody. Western Blot analysis of SNRPA1 expression in human liver.)

Western Blot (WB)

(Western Blot analysis of SNRPA1 expression in transfected 293T cell line by SNRPA1 polyclonal antibody. Lane 1: SNRPA1 transfected lysate (28.05kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-SNRPA1 antibody

SNRPA1, a 28kD protein, is a specific component of U2 snRNP particle and consists of a unique N-terminal leucine-rich region and an extremely hydrophobic RNA-binding C-terminal region. It lacks segments homologous to RNP1 and RNP2, common aa motifs found in several RNA-binding proteins. It associates with U2 snRNP and participates in transcription and pre-mRNA splicing. It might play an important role in cell division and proliferation. Patients with connective tissue disorders often produce autoantibodies against snRNP particles.

Product Categories/Family for anti-SNRPA1 antibody

Antibodies; Abs to Nuclear Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 45709273
• NCBI GeneID: 6627
• UniProt Accession #: P09661; Q8TBD2; B2R5I6
• Molecular Weight: 28,416 Da
• NCBI Official Full Name: SNRPA1 protein
• NCBI Official Synonym Full Names: small nuclear ribonucleoprotein polypeptide A'
• NCBI Official Symbol: SNRPA1
• NCBI Official Synonym Symbols: Lea1
• NCBI Protein Information: U2 small nuclear ribonucleoprotein A'; U2 snRNP A'; U2 small nuclear ribonucleoprotein polypeptide A'
• UniProt Protein Name: U2 small nuclear ribonucleoprotein A'
• UniProt Gene Name: SNRPA1
• UniProt Synonym Gene Names: U2 snRNP A'
• UniProt Entry Name: RU2A_HUMAN

Uniprot Description

Function: This protein is associated with sn-RNP U2. It helps the A' protein to bind stem loop IV of U2 snRNA.

Subunit structure: Identified in the spliceosome C complex. Found in a pre-mRNA splicing complex with SFRS4, SFRS5, SNRNP70, SNRPA1, SRRM1 and SRRM2. Found in a pre-mRNA exonic splicing enhancer (ESE) complex with SNRNP70, SNRPA1, SRRM1 and TRA2B. Ref.6 Ref.7 Ref.8

Subcellular location: Nucleus.

Sequence similarities: Belongs to the U2 small nuclear ribonucleoprotein A family.Contains 4 LRR (leucine-rich) repeats.Contains 1 LRRCT domain.