Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of SNCG expression in transfected 293T cell line by SNCG polyclonal antibody. Lane 1: SNCG transfected lysate (13.3kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human SNCG Polyclonal Antibody | anti-SNCG antibody

SNCG (Gamma-synuclein, Breast Cancer-specific Gene 1 Protein, Persyn, Synoretin, SR, BCSG1, PERSYN, PRSN) (FITC)

Gene Names
SNCG; SR; BCSG1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SNCG; Polyclonal Antibody; SNCG (Gamma-synuclein; Breast Cancer-specific Gene 1 Protein; Persyn; Synoretin; SR; BCSG1; PERSYN; PRSN) (FITC); anti-SNCG antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SNCG.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Sequence Length
758
Applicable Applications for anti-SNCG antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human SNCG, aa1-127 (AAH14098.1).
Immunogen Sequence
MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of SNCG expression in transfected 293T cell line by SNCG polyclonal antibody. Lane 1: SNCG transfected lysate (13.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SNCG expression in transfected 293T cell line by SNCG polyclonal antibody. Lane 1: SNCG transfected lysate (13.3kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-SNCG antibody
Synuclein, gamma is a 127aa protein (~14kD) which belongs to the synuclein family, which also includes alpha-and beta-synuclein. Three synucleins are located in the neuronal cytosol and enriched in presynaptic terminals, while SYN is also expressed in many other non-neuronal tissues. SYN is abnormally expressed in a high percentage of tumor tissues of diversified cancer types, including liver, esophagus, colon, gastric, lung, prostate, cervical, and breast cancer, but rarely expressed in tumor-matched nonneoplastic adjacent tissues. High levels of SYN have been identified in advanced breast carcinomas suggesting a correlation between overexpression of SYN and breast tumor development.
Product Categories/Family for anti-SNCG antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens synuclein, gamma (breast cancer-specific protein 1), mRNA
NCBI Official Synonym Full Names
synuclein gamma
NCBI Official Symbol
SNCG
NCBI Official Synonym Symbols
SR; BCSG1
NCBI Protein Information
gamma-synuclein
Protein Family

NCBI Description

This gene encodes a member of the synuclein family of proteins which are believed to be involved in the pathogenesis of neurodegenerative diseases. Mutations in this gene have also been associated with breast tumor development. [provided by RefSeq, Jan 2010]

Research Articles on SNCG

Similar Products

Product Notes

The SNCG (Catalog #AAA6394600) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SNCG (Gamma-synuclein, Breast Cancer-specific Gene 1 Protein, Persyn, Synoretin, SR, BCSG1, PERSYN, PRSN) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SNCG can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SNCG for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SNCG, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.