Western Blot (WB)
(Host: RabbitTarget Name: SNAPINSample Tissue: Mouse Thymus lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Mouse SNAPIN Polyclonal Antibody | anti-SNAPIN antibody
SNAPIN Antibody-middlel region
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SNAPIN; Polyclonal Antibody; SNAPIN Antibody-middlel region; SNARE-associated protein Snapin; 25kDa; Snapap; Bloc1s7; AA407989; AV026596; Snap25bp; anti-SNAPIN antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
Sequence
LNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGVYPPGSPS
Applicable Applications for anti-SNAPIN antibody
Western Blot (WB)
Protein Size
136 amino acids
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse SNAPIN
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: SNAPINSample Tissue: Mouse Thymus lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: SNAPINSample Tissue: Mouse Thymus lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-SNAPIN antibody
Description of Target: Component of the BLOC-1 complex, a complex that is required for normal biogenesis of lysosome-related organelles (LRO), such as platelet dense granules and melanosomes. In concert with the AP-3 complex, the BLOC-1 complex is required to target membrane protein cargos into vesicles assembled at cell bodies for delivery into neurites and nerve terminals. The BLOC-1 complex, in association with SNARE proteins, is also proposed to be involved in neurite extension. Plays a role in intracellular vesicle trafficking and synaptic vesicle recycling. May modulate a step between vesicle priming, fusion and calcium-dependent neurotransmitter release through its ability to potentiate the interaction of synaptotagmin with the SNAREs and the plasma-membrane-associated protein SNAP25. Its phosphorylation state influences exocytotic protein interactions and may regulate synaptic vesicle exocytosis. May also have a role in the mechanisms of SNARE-mediated membrane fusion in non-neuronal cells. As part of the BORC complex may play a role in lysosomes movement and localization at the cell periphery. Associated with the cytosolic face of lysosomes, the BORC complex may recruit ARL8B and couple lysosomes to microtubule plus-end-directed kinesin motor (By similarity).
NCBI and Uniprot Product Information
NCBI GeneID
UniProt Accession #
Molecular Weight
14kDa
UniProt Protein Name
SNARE-associated protein Snapin
Protein Family
UniProt Gene Name
Snapin
UniProt Synonym Gene Names
Bloc1s7; Snap25bp; Snapap; BLOC-1 subunit 7; SNAP-associated protein
UniProt Entry Name
SNAPN_MOUSE
Similar Products
Product Notes
The SNAPIN snapin (Catalog #AAA3249749) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SNAPIN Antibody-middlel region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's SNAPIN can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SNAPIN snapin for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LNARRRVVLV NNILQNAQER LRRLNHSVAK ETARRRAMLD SGVYPPGSPS. It is sometimes possible for the material contained within the vial of "SNAPIN, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
