Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-EDC3 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole CellEDC3 is supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit EDC3 Polyclonal Antibody | anti-EDC3 antibody

EDC3 Antibody - middle region

Gene Names
EDC3; YJDC; LSM16; MRT50; YJEFN2; hYjeF_N2-15q23
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
EDC3; Polyclonal Antibody; EDC3 Antibody - middle region; anti-EDC3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KKSGLKNGQMKNKDDECFGDDIEEIPDTDFDFEGNLALFDKAAVFEEIDT
Sequence Length
508
Applicable Applications for anti-EDC3 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 87%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human EDC3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-EDC3 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole CellEDC3 is supported by BioGPS gene expression data to be expressed in Jurkat)

Western Blot (WB) (WB Suggested Anti-EDC3 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole CellEDC3 is supported by BioGPS gene expression data to be expressed in Jurkat)
Related Product Information for anti-EDC3 antibody
This is a rabbit polyclonal antibody against EDC3. It was validated on Western Blot

Target Description: EDC3 is associated with an mRNA-decapping complex required for removal of the 5-prime cap from mRNA prior to its degradation from the 5-prime end.
Product Categories/Family for anti-EDC3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
enhancer of mRNA-decapping protein 3 isoform 1
NCBI Official Synonym Full Names
enhancer of mRNA decapping 3
NCBI Official Symbol
EDC3
NCBI Official Synonym Symbols
YJDC; LSM16; MRT50; YJEFN2; hYjeF_N2-15q23
NCBI Protein Information
enhancer of mRNA-decapping protein 3
UniProt Protein Name
Enhancer of mRNA-decapping protein 3
UniProt Gene Name
EDC3
UniProt Synonym Gene Names
LSM16; YJDC; YJEFN2; YjeF_N2; hYjeF_N2
UniProt Entry Name
EDC3_HUMAN

NCBI Description

This gene encodes a protein that is important in mRNA degradation. The encoded protein is a component of a decapping complex that promotes efficient removal of the monomethylguanosine (m7G) cap from mRNAs, as part of the 5' to 3' mRNA decay pathway. Mutations in this gene have been identified in human patients with an autosomal recessive form of intellectual disability. [provided by RefSeq, May 2017]

Research Articles on EDC3

Similar Products

Product Notes

The EDC3 edc3 (Catalog #AAA3216584) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EDC3 Antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's EDC3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the EDC3 edc3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KKSGLKNGQM KNKDDECFGD DIEEIPDTDF DFEGNLALFD KAAVFEEIDT. It is sometimes possible for the material contained within the vial of "EDC3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.