Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of SNAI1 expression in transfected 293T cell line by SNAI1 polyclonal antibody. Lane 1: SNAI1 transfected lysate (29.1kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human SNAI1 Polyclonal Antibody | anti-SNAI1 antibody

SNAI1 (SNAH, Zinc Finger Protein SNAI1, Protein Snail Homolog 1, Protein Sna) (HRP)

Gene Names
SNAI1; SNA; SNAH; SNAIL; SLUGH2; SNAIL1; dJ710H13.1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SNAI1; Polyclonal Antibody; SNAI1 (SNAH; Zinc Finger Protein SNAI1; Protein Snail Homolog 1; Protein Sna) (HRP); anti-SNAI1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SNAI1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
Applicable Applications for anti-SNAI1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human SNAI1, aa1-264 (NP_005976.2).
Immunogen Sequence
MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEILNPTASLPMLIWDSVLAPQAQPIAWASLRLQESPRVAELTSLSDEDSGKGSQPPSPPSPAPSSFSSTSVSSLEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYLSLGALKMHIRSHTLPCVCGTCGKAFSRPWLLQGHVRTHTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCQACARTFSRMSLLHKHQESGCSGCPR
Conjugate
HRP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of SNAI1 expression in transfected 293T cell line by SNAI1 polyclonal antibody. Lane 1: SNAI1 transfected lysate (29.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SNAI1 expression in transfected 293T cell line by SNAI1 polyclonal antibody. Lane 1: SNAI1 transfected lysate (29.1kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-SNAI1 antibody
The Drosophila embryonic protein snail is a zinc finger transcriptional repressor which downregulates the expression of ectodermal genes within the mesoderm. The nuclear protein encoded by this gene is structurally similar to the Drosophila snail protein, and is also thought to be critical for mesoderm formation in the developing embryo. At least two variants of a similar processed pseudogene have been found on chromosome 2.
Product Categories/Family for anti-SNAI1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29,083 Da
NCBI Official Full Name
zinc finger protein SNAI1
NCBI Official Synonym Full Names
snail family zinc finger 1
NCBI Official Symbol
SNAI1
NCBI Official Synonym Symbols
SNA; SNAH; SNAIL; SLUGH2; SNAIL1; dJ710H13.1
NCBI Protein Information
zinc finger protein SNAI1; protein sna; snail 1 homolog; snail homolog 1; protein snail homolog 1; snail 1 zinc finger protein; snail 1, zinc finger protein
UniProt Protein Name
Zinc finger protein SNAI1
Protein Family
UniProt Gene Name
SNAI1
UniProt Synonym Gene Names
SNAH; Protein sna
UniProt Entry Name
SNAI1_HUMAN

NCBI Description

The Drosophila embryonic protein snail is a zinc finger transcriptional repressor which downregulates the expression of ectodermal genes within the mesoderm. The nuclear protein encoded by this gene is structurally similar to the Drosophila snail protein, and is also thought to be critical for mesoderm formation in the developing embryo. At least two variants of a similar processed pseudogene have been found on chromosome 2. [provided by RefSeq, Jul 2008]

Uniprot Description

Snail1: a protein of the C2H2-type zinc-finger family that regulates transcription. Involved in embryonic mesoderm formation. Plays a role in the epithelial to mesenchymal transition (EMT). EMT is characterized by decreased levels of the epithelial markers E-cadherin and alpha- and beta-catenin, and increased cellular migration and expression of the mesenchymal markers fibronectin, vimentin, N-cadherin and smooth muscle alpha-actin.E Snail binds to 3 E-boxes of the E-cadherin gene promoter and represses its transcription. NF-kappaB binds and regulates the snail promoter and is critical for EMT, and inhibition of NF-kappaB activity lowered snail levels and morphologically reversed the EMT.

Protein type: Transcription factor; C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 20q13.2

Cellular Component: cytoplasm; nucleus

Molecular Function: protein binding; metal ion binding; kinase binding

Biological Process: osteoblast differentiation; negative regulation of DNA damage response, signal transduction by p53 class mediator; cell migration; hair follicle morphogenesis; mesoderm formation; positive regulation of transcription, DNA-dependent; epithelial to mesenchymal transition; negative regulation of transcription from RNA polymerase II promoter; palate development; positive regulation of cell migration

Research Articles on SNAI1

Similar Products

Product Notes

The SNAI1 snai1 (Catalog #AAA6394546) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SNAI1 (SNAH, Zinc Finger Protein SNAI1, Protein Snail Homolog 1, Protein Sna) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SNAI1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SNAI1 snai1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SNAI1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.