Western Blot (WB)
(Host: RabbitTarget Name: SMTNL1Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Rabbit SMTNL1 Polyclonal Antibody | anti-SMTNL1 antibody
SMTNL1 Antibody - N-terminal region
Gene Names
SMTNL1; CHASM
Reactivity
Dog, Human, Pig, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SMTNL1; Polyclonal Antibody; SMTNL1 Antibody - N-terminal region; anti-SMTNL1 antibody
Host
Rabbit
Reactivity
Dog, Human, Pig, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: REAGGKEDAEAELKKEDGEKEETTVGSQEMTGRKEETKSEPKEAEEKEST
Sequence Length
457
Applicable Applications for anti-SMTNL1 antibody
Western Blot (WB)
Homology
Dog: 85%; Human: 100%; Pig: 77%; Yeast: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human SMTNL1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: SMTNL1Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: SMTNL1Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-SMTNL1 antibody
This is a rabbit polyclonal antibody against SMTNL1. It was validated on Western Blot
Product Categories/Family for anti-SMTNL1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
50kDa
NCBI Official Full Name
Smoothelin-like protein 1
NCBI Official Synonym Full Names
smoothelin like 1
NCBI Official Symbol
SMTNL1
NCBI Official Synonym Symbols
CHASM
NCBI Protein Information
smoothelin-like protein 1
UniProt Protein Name
Smoothelin-like protein 1
Protein Family
UniProt Gene Name
SMTNL1
UniProt Entry Name
SMTL1_HUMAN
NCBI Description
The protein encoded by this gene is involved in the contraction of both striated and smooth muscle. During pregnancy, the encoded protein interacts with progesterone receptor to attenuate the expression of contractile and metabolic proteins. [provided by RefSeq, Jul 2016]
Research Articles on SMTNL1
Similar Products
Product Notes
The SMTNL1 smtnl1 (Catalog #AAA3217201) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SMTNL1 Antibody - N-terminal region reacts with Dog, Human, Pig, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's SMTNL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SMTNL1 smtnl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: REAGGKEDAE AELKKEDGEK EETTVGSQEM TGRKEETKSE PKEAEEKEST. It is sometimes possible for the material contained within the vial of "SMTNL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
