Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Slc9a3r2 AntibodyTitration: 1.0 ug/mlPositive Control: Rat Brain)

Rabbit Slc9a3r2 Polyclonal Antibody | anti-SLC9A3R2 antibody

Slc9a3r2 antibody - N-terminal region

Gene Names
Slc9a3r2; E3karp
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Slc9a3r2; Polyclonal Antibody; Slc9a3r2 antibody - N-terminal region; anti-SLC9A3R2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100ul at 0.5-1 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: RLVRGEQGYGFHLHGEKGRRGQFIRRVEPGSPAEAAALRAGDRLVEVNGV
Sequence Length
337
Applicable Applications for anti-SLC9A3R2 antibody
Western Blot (WB)
Protein Size
650 Amino Acids
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 85%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Rat
Protein Interactions
AGPAT2; Nedd4; UBC
Complete Computational Species Homology Data
Anti-SLC23A2 (MBS3207098)
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Slc9a3r2 AntibodyTitration: 1.0 ug/mlPositive Control: Rat Brain)

Western Blot (WB) (WB Suggested Anti-Slc9a3r2 AntibodyTitration: 1.0 ug/mlPositive Control: Rat Brain)
Related Product Information for anti-SLC9A3R2 antibody
This is a rabbit polyclonal antibody against Slc9a3r2. It was validated on Western Blot

Target Description: Scaffold protein that connects plasma membrane proteins with members of the ezrin/moesin/radixin family and thereby helps to link them to the actin cytoskeleton and to regulate their surface expression. Slc9a3r2 is necessary for cAMP-mediated phosphorylation and inhibition of SLC9A3. It may also act as scaffold protein in the nucleus.
Product Categories/Family for anti-SLC9A3R2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
70kDa
NCBI Official Full Name
Na(+)/H(+) exchange regulatory cofactor NHE-RF2
NCBI Official Synonym Full Names
SLC9A3 regulator 2
NCBI Official Symbol
Slc9a3r2
NCBI Official Synonym Symbols
E3karp
NCBI Protein Information
Na(+)/H(+) exchange regulatory cofactor NHE-RF2
UniProt Protein Name
Na(+)/H(+) exchange regulatory cofactor NHE-RF2
UniProt Gene Name
Slc9a3r2
UniProt Synonym Gene Names
Nherf2; NHERF-2; SIP-1; TKA-1

NCBI Description

a membrane-cytoskeleton linking protein; participates in coordinating cAMP-regulated ion transport in the epithelia [RGD, Feb 2006]

Uniprot Description

Scaffold protein that connects plasma membrane proteins with members of the ezrin/moesin/radixin family and thereby helps to link them to the actin cytoskeleton and to regulate their surface expression. Necessary for cAMP-mediated phosphorylation and inhibition of SLC9A3. May also act as scaffold protein in the nucleus.

Research Articles on SLC9A3R2

Similar Products

Product Notes

The SLC9A3R2 slc9a3r2 (Catalog #AAA3207089) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Slc9a3r2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Slc9a3r2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLC9A3R2 slc9a3r2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RLVRGEQGYG FHLHGEKGRR GQFIRRVEPG SPAEAAALRA GDRLVEVNGV. It is sometimes possible for the material contained within the vial of "Slc9a3r2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.