Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (PAPD4 antibody (MBS839649) used at 1 ug/ml to detect target protein.)

Rabbit PAPD4 Polyclonal Antibody | anti-PAPD4 antibody

PAPD4 antibody

Gene Names
PAPD4; GLD2; TUT2
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
PAPD4; Polyclonal Antibody; PAPD4 antibody; Polyclonal PAPD4; Anti-PAPD4; PAPD 4; PAPD-4; FLJ38499; Pap Associated Domain Containing 4; anti-PAPD4 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
PAPD4 antibody was raised against the N terminal of PAPD4
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PAPD4 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
484
Applicable Applications for anti-PAPD4 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
PAPD4 is a cytoplasmic poly(A) RNA polymerase that adds successive AMP monomers to the 3'-end of specific RNAs, forming a poly(A) tail. In contrast to the canonical nuclear poly(A) RNA polymerase, it only adds poly(A) to selected cytoplasmic mRNAs. PAPD4 belongs to the DNA polymerase type-B-like family, GLD2 subfamily.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
PAPD4 antibody was raised using the N terminal of PAPD4 corresponding to a region with amino acids GRKRLSDEKNLPLDGKRQRFHSPHQEPTVVNQIVPLSGERRYSMPPLFHT
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(PAPD4 antibody (MBS839649) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (PAPD4 antibody (MBS839649) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-PAPD4 antibody
Rabbit polyclonal PAPD4 antibody raised against the N terminal of PAPD4
Product Categories/Family for anti-PAPD4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
56 kDa (MW of target protein)
NCBI Official Full Name
PAPD4 protein
NCBI Official Synonym Full Names
PAP associated domain containing 4
NCBI Official Symbol
PAPD4
NCBI Official Synonym Symbols
GLD2; TUT2
NCBI Protein Information
poly(A) RNA polymerase GLD2
UniProt Protein Name
Poly(A) RNA polymerase GLD2
Protein Family
UniProt Gene Name
PAPD4
UniProt Synonym Gene Names
GLD2; hGLD-2; TUTase 2
UniProt Entry Name
GLD2_HUMAN

Uniprot Description

PAPD4: Cytoplasmic poly(A) RNA polymerase that adds successive AMP monomers to the 3'-end of specific RNAs, forming a poly(A) tail. In contrast to the canonical nuclear poly(A) RNA polymerase, it only adds poly(A) to selected cytoplasmic mRNAs. Does not play a role in replication-dependent histone mRNA degradation. Belongs to the DNA polymerase type-B-like family. GLD2 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: RNA processing; EC 2.7.7.19; Transferase

Chromosomal Location of Human Ortholog: 5q14.1

Cellular Component: cytoplasm

Molecular Function: polynucleotide adenylyltransferase activity; metal ion binding; ATP binding

Biological Process: RNA polyadenylation; hemopoietic progenitor cell differentiation; mRNA processing

Research Articles on PAPD4

Similar Products

Product Notes

The PAPD4 papd4 (Catalog #AAA839649) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PAPD4 antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PAPD4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the PAPD4 papd4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PAPD4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.