Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of GPR172B expression in transfected 293T cell line by GPR172B polyclonal antibody. Lane 1: GPR172B transfected lysate (46.4kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human SLC52A1 Polyclonal Antibody | anti-SLC52A1 antibody

SLC52A1 (Solute Carrier Family 52, Riboflavin Transporter, Member 1, Porcine Endogenous Retrovirus A Receptor 2, PERV-A Receptor 2, Protein GPR172B, Riboflavin Transporter 1, hRFT1, GPR172B, PAR2, RFT1)

Gene Names
SLC52A1; PAR2; RFT1; RBFVD; RFVT1; hRFT1; GPCR42; GPR172B
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
SLC52A1; Polyclonal Antibody; SLC52A1 (Solute Carrier Family 52; Riboflavin Transporter; Member 1; Porcine Endogenous Retrovirus A Receptor 2; PERV-A Receptor 2; Protein GPR172B; Riboflavin Transporter 1; hRFT1; GPR172B; PAR2; RFT1); Anti -SLC52A1 (Solute Carrier Family 52; anti-SLC52A1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human GPR172B.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MAAPTLGRLVLTHLLVALFGMGSWAAVNGIWVELPVVVKDLPEGWSLPSYLSVVVALGNLGLLVVTLWRRLAPGKGEQVPIQVVQVLSVVGTALLAPLWHHVAPVAGQLHSVAFLTLALVLAMACCTSNVTFLPFLSHLPPPFLRSFFLGQGLSALLPCVLALVQGVGRLECPPAPTNGTSGPPLDFPERFPASTFFWALTALLVTSAAAFRGLLLLLPSLPSVTTGGSGPELQLGSPGAEEEEKEEEEALPLQEPPSQAAGTIPGPDPEVHQLFSAHGAFLLGLMAFTSAVTNGVLPSVQSFSCLPYGRLAYHLAVVLGSAANPLACFLAMGVLCRSLAGLVGLSLLGMLFGAYLMALAILSPCPPLVGTTAGVVLVVLSWVLCLCVFSYVKVAASSLLHGGGRPALLAAGVAIQVGSLLGAGAMFPPTSIYHVFQSRKDCVDPCGP
Applicable Applications for anti-SLC52A1 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human GPR172B, aa1-448 (NP_060456.2).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of GPR172B expression in transfected 293T cell line by GPR172B polyclonal antibody. Lane 1: GPR172B transfected lysate (46.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of GPR172B expression in transfected 293T cell line by GPR172B polyclonal antibody. Lane 1: GPR172B transfected lysate (46.4kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-SLC52A1 antibody
Riboflavin transporter. Riboflavin transport is Na+-independent but moderately pH-sensitive. Activity is strongly inhibited by riboflavin analogs, such as lumiflavin. Weakly inhibited by flavin adenine dinucleotide (FAD). In case of infection by retroviruses, acts as a cell receptor to retroviral envelopes similar to the porcine endogenous retrovirus (PERV-A).
Product Categories/Family for anti-SLC52A1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46,317 Da
NCBI Official Full Name
solute carrier family 52, riboflavin transporter, member 1
NCBI Official Synonym Full Names
solute carrier family 52 (riboflavin transporter), member 1
NCBI Official Symbol
SLC52A1
NCBI Official Synonym Symbols
PAR2; RFT1; RBFVD; RFVT1; hRFT1; GPCR42; GPR172B
NCBI Protein Information
solute carrier family 52, riboflavin transporter, member 1; PERV-A receptor 2; G protein-coupled receptor 172B; G-protein coupled receptor GPCR42; porcine endogenous retrovirus A receptor 2
UniProt Protein Name
Solute carrier family 52, riboflavin transporter, member 1
Protein Family
UniProt Gene Name
SLC52A1
UniProt Synonym Gene Names
GPR172B; PAR2; RFT1; PERV-A receptor 2; hRFT1
UniProt Entry Name
S52A1_HUMAN

NCBI Description

Biological redox reactions require electron donors and acceptor. Vitamin B2 is the source for the flavin in flavin adenine dinucleotide (FAD) and flavin mononucleotide (FMN) which are common redox reagents. This gene encodes a member of the riboflavin (vitamin B2) transporter family. Haploinsufficiency of this protein can cause maternal riboflavin deficiency. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jan 2013]

Uniprot Description

Function: Riboflavin transporter. Riboflavin transport is Na+-independent but moderately pH-sensitive. Activity is strongly inhibited by riboflavin analogs, such as lumiflavin. Weakly inhibited by flavin adenine dinucleotide (FAD). In case of infection by retroviruses, acts as a cell receptor to retroviral envelopes similar to the porcine endogenous retrovirus (PERV-A). Ref.1 Ref.7

Subcellular location: Cell membrane; Multi-pass membrane protein Ref.2 Ref.7.

Tissue specificity: Widely expressed. Highly expressed in the testis, placenta and small intestine. Expressed at lower level in other tissues. Ref.1 Ref.2 Ref.7

Involvement in disease: Riboflavin deficiency (RBFVD) [MIM:615026]: A disorder caused by a primary defect in riboflavin metabolism, or by dietary riboflavin deficiency. Riboflavin deficiency during pregnancy results in hypoglycemia, metabolic acidosis, dicarboxylic aciduria and elevated plasma acylcarnitine levels in the newborn. Treatment with oral riboflavin results in complete resolution of the clinical and biochemical findings.Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.8

Sequence similarities: Belongs to the riboflavin transporter family.

Biophysicochemical propertiesKinetic parameters:KM=1.38 µM for riboflavin Ref.7

Research Articles on SLC52A1

Similar Products

Product Notes

The SLC52A1 slc52a1 (Catalog #AAA648594) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC52A1 (Solute Carrier Family 52, Riboflavin Transporter, Member 1, Porcine Endogenous Retrovirus A Receptor 2, PERV-A Receptor 2, Protein GPR172B, Riboflavin Transporter 1, hRFT1, GPR172B, PAR2, RFT1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC52A1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the SLC52A1 slc52a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAAPTLGRLV LTHLLVALFG MGSWAAVNGI WVELPVVVKD LPEGWSLPSY LSVVVALGNL GLLVVTLWRR LAPGKGEQVP IQVVQVLSVV GTALLAPLWH HVAPVAGQLH SVAFLTLALV LAMACCTSNV TFLPFLSHLP PPFLRSFFLG QGLSALLPCV LALVQGVGRL ECPPAPTNGT SGPPLDFPER FPASTFFWAL TALLVTSAAA FRGLLLLLPS LPSVTTGGSG PELQLGSPGA EEEEKEEEEA LPLQEPPSQA AGTIPGPDPE VHQLFSAHGA FLLGLMAFTS AVTNGVLPSV QSFSCLPYGR LAYHLAVVLG SAANPLACFL AMGVLCRSLA GLVGLSLLGM LFGAYLMALA ILSPCPPLVG TTAGVVLVVL SWVLCLCVFS YVKVAASSLL HGGGRPALLA AGVAIQVGSL LGAGAMFPPT SIYHVFQSRK DCVDPCGP. It is sometimes possible for the material contained within the vial of "SLC52A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.