Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-SLC40A1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Plasma membrane in intercalated diskPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit SLC40A1 Polyclonal Antibody | anti-SLC40A1 antibody

SLC40A1 antibody - middle region

Gene Names
SLC40A1; FPN1; HFE4; MTP1; IREG1; MST079; MSTP079; SLC11A3
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
SLC40A1; Polyclonal Antibody; SLC40A1 antibody - middle region; anti-SLC40A1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GSPLDLSVSPFEDIRSRFIQGESITPTKIPEITTEIYMSNGSNSANIVPE
Sequence Length
571
Applicable Applications for anti-SLC40A1 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Homology
Cow: 93%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 86%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SLC40A1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-SLC40A1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Plasma membrane in intercalated diskPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Rabbit Anti-SLC40A1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Plasma membrane in intercalated diskPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(WB Suggested Anti-SLC40A1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-SLC40A1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)
Related Product Information for anti-SLC40A1 antibody
This is a rabbit polyclonal antibody against SLC40A1. It was validated on Western Blot

Target Description: The protein encoded by this gene is a cell membrane protein that may be involved in iron export from duodenal epithelial cells. Defects in this gene are a cause of hemochromatosis type 4 (HFE4).
Product Categories/Family for anti-SLC40A1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62kDa
NCBI Official Full Name
solute carrier family 40 member 1
NCBI Official Synonym Full Names
solute carrier family 40 member 1
NCBI Official Symbol
SLC40A1
NCBI Official Synonym Symbols
FPN1; HFE4; MTP1; IREG1; MST079; MSTP079; SLC11A3
NCBI Protein Information
solute carrier family 40 member 1
UniProt Protein Name
Solute carrier family 40 member 1
UniProt Gene Name
SLC40A1
UniProt Synonym Gene Names
FPN1; IREG1; SLC11A3
UniProt Entry Name
S40A1_HUMAN

NCBI Description

The protein encoded by this gene is a cell membrane protein that may be involved in iron export from duodenal epithelial cells. Defects in this gene are a cause of hemochromatosis type 4 (HFE4). [provided by RefSeq, Jul 2008]

Uniprot Description

SLC40A1: May be involved in iron export from duodenal epithelial cell and also in transfer of iron between maternal and fetal circulation. Mediates iron efflux in the presence of a ferroxidase (hephaestin and/or ceruloplasmin). Defects in SLC40A1 are the cause of hemochromatosis type 4 (HFE4). HFE4 is an autosomal dominant iron-loading disorder characterized by early iron accumulation in reticuloendothelial cells and a marked increase in serum ferritin before elevation of the transferrin saturation. Belongs to the ferroportin (FP) (TC 2.A.100) family. SLC40A subfamily.

Protein type: Transporter, SLC family; Membrane protein, integral; Transporter; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 2q32

Cellular Component: multivesicular body; synaptic vesicle; integral to plasma membrane; basolateral plasma membrane; cytoplasm; plasma membrane; integral to membrane; intracellular

Molecular Function: protein binding; iron ion transmembrane transporter activity

Biological Process: anatomical structure morphogenesis; cellular iron ion homeostasis; positive regulation of transcription from RNA polymerase II promoter; transmembrane transport; lymphocyte homeostasis; negative regulation of apoptosis

Disease: Hemochromatosis, Type 4

Research Articles on SLC40A1

Similar Products

Product Notes

The SLC40A1 slc40a1 (Catalog #AAA3207124) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC40A1 antibody - middle region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SLC40A1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). Researchers should empirically determine the suitability of the SLC40A1 slc40a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GSPLDLSVSP FEDIRSRFIQ GESITPTKIP EITTEIYMSN GSNSANIVPE. It is sometimes possible for the material contained within the vial of "SLC40A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.