Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Primary Antibody Dilution :1:200Secondary Antibody :Goat anti-rabbit Alexafluor 568Secondary Antibody Dilution :1:200Color/Signal Descriptions :SLC38A3: Red CtBp: Green DAPI: BlueGene Name :SLC38A3Submitted by :Anonymous)

Rabbit SLC38A3 Polyclonal Antibody | anti-SLC38A3 antibody

SLC38A3 antibody - N-terminal region

Gene Names
SLC38A3; G17; SN1; NAT1; SNAT3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
SLC38A3; Polyclonal Antibody; SLC38A3 antibody - N-terminal region; anti-SLC38A3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GNQRVEDPARSCMEGKSFLQKSPSKEPHFTDFEGKTSFGMSVFNLSNAIM
Sequence Length
504
Applicable Applications for anti-SLC38A3 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC38A3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Primary Antibody Dilution :1:200Secondary Antibody :Goat anti-rabbit Alexafluor 568Secondary Antibody Dilution :1:200Color/Signal Descriptions :SLC38A3: Red CtBp: Green DAPI: BlueGene Name :SLC38A3Submitted by :Anonymous)

Immunohistochemistry (IHC) (Primary Antibody Dilution :1:200Secondary Antibody :Goat anti-rabbit Alexafluor 568Secondary Antibody Dilution :1:200Color/Signal Descriptions :SLC38A3: Red CtBp: Green DAPI: BlueGene Name :SLC38A3Submitted by :Anonymous)
Related Product Information for anti-SLC38A3 antibody
This is a rabbit polyclonal antibody against SLC38A3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: As a sodium-dependent amino acid/proton antiporter, SLC38A3 mediates electrogenic cotransport of glutamine and sodium ions in exchange for protons. It also recognizes histidine, asparagine and alanine. It may mediate amino acid transport in either direction under physiological conditions and£íay play a role in nitrogen metabolism and synaptic transmission.
Product Categories/Family for anti-SLC38A3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
sodium-coupled neutral amino acid transporter 3
NCBI Official Synonym Full Names
solute carrier family 38 member 3
NCBI Official Symbol
SLC38A3
NCBI Official Synonym Symbols
G17; SN1; NAT1; SNAT3
NCBI Protein Information
sodium-coupled neutral amino acid transporter 3
UniProt Protein Name
Sodium-coupled neutral amino acid transporter 3
UniProt Gene Name
SLC38A3
UniProt Entry Name
S38A3_HUMAN

Uniprot Description

SLC38A3: Sodium-dependent amino acid/proton antiporter. Mediates electrogenic cotransport of glutamine and sodium ions in exchange for protons. Also recognizes histidine, asparagine and alanine. May mediate amino acid transport in either direction under physiological conditions. May play a role in nitrogen metabolism and synaptic transmission. Belongs to the amino acid/polyamine transporter 2 family.

Protein type: Transporter; Transporter, SLC family; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 3p21.3

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: L-histidine transmembrane transporter activity; symporter activity; L-asparagine transmembrane transporter activity; L-alanine transmembrane transporter activity; L-glutamine transmembrane transporter activity; antiporter activity

Biological Process: amino acid transport; asparagine transport; sodium ion transport; histidine transport; ion transport; glutamine transport; transmembrane transport; L-alanine transport

Research Articles on SLC38A3

Similar Products

Product Notes

The SLC38A3 slc38a3 (Catalog #AAA3206305) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC38A3 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's SLC38A3 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the SLC38A3 slc38a3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GNQRVEDPAR SCMEGKSFLQ KSPSKEPHFT DFEGKTSFGM SVFNLSNAIM. It is sometimes possible for the material contained within the vial of "SLC38A3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.