Rabbit SLC33A1 Polyclonal Antibody | anti-SLC33A1 antibody

SLC33A1 antibody - middle region

Cat. Num. AAA3207088

• Gene Names: SLC33A1; AT1; AT-1; ACATN; SPG42; CCHLND
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
• Applications: Western Blot, Immunohistochemistry
• Purity: Affinity Purified
• Synonyms: SLC33A1; Polyclonal Antibody; SLC33A1 antibody - middle region; anti-SLC33A1 antibody

• Host: Rabbit
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: CNSVGQTAGYFLGNVLFLALESADFCNKYLRFQPQPRGIVTLSDFLFFWG
• Sequence Length: 549

• Applicable Applications for anti-SLC33A1 antibody: Western Blot (WB), Immunohistochemistry (IHC)
• Homology: Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC33A1
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-SLC33A1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult heartObserved Staining: Cytoplasmic,MembranePrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

Immunohistochemistry (IHC)

(Rabbit Anti-SLC33A1 antibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult Small intestineObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(Host: RabbitTarget Name: EGFL8Sample Type: HelaAntibody Dilution: 1.0ug/mlSLC33A1 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)

Western Blot (WB)

(Host: RabbitTarget Name: NOP56Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: WT1Sample Type: 721_BAntibody Dilution: 1.0ug/mlSLC33A1 is supported by BioGPS gene expression data to be expressed in 721_B)

Western Blot (WB)

(WB Suggested Anti-SLC33A1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Placenta)

Western Blot (WB)

(WB Suggested Anti-SLC33A1 antibody Titration: 1 ug/mLSample Type: Human heart)

Western Blot (WB)

(WB Suggested Anti-SLC33A1 antibody Titration: 1 ug/mLSample Type: Human liver)

Related Product Information for anti-SLC33A1 antibody

This is a rabbit polyclonal antibody against SLC33A1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SLC33A1 is required for the formation of O-acetylated (Ac) gangliosides. It is predicted to contain 6 to 10 transmembrane domains, and a leucine zipper motif in transmembrane domain III. Studies indicate that the protein is localized to the cytoplasm.The encoded protein is required for the formation of O-acetylated (Ac) gangliosides. It is predicted to contain 6 to 10 transmembrane domains, and a leucine zipper motif in transmembrane domain III. Studies indicate that the protein is localized to the cytoplasm.

Product Categories/Family for anti-SLC33A1 antibody

Polyclonal; Membrane Protein

NCBI and Uniprot Product Information

• NCBI GI #: 4757708
• NCBI GeneID: 9197
• NCBI Accession #: NP_004724
• NCBI GenBank Nucleotide #: NM_004733
• UniProt Accession #: O00400
• Molecular Weight: 61kDa
• NCBI Official Full Name: acetyl-coenzyme A transporter 1 isoform 1
• NCBI Official Synonym Full Names: solute carrier family 33 member 1
• NCBI Official Symbol: SLC33A1
• NCBI Official Synonym Symbols: AT1; AT-1; ACATN; SPG42; CCHLND
• NCBI Protein Information: acetyl-coenzyme A transporter 1
• UniProt Protein Name: Acetyl-coenzyme A transporter 1
• Protein Family: Acetyl-coenzyme A transporter
• UniProt Gene Name: SLC33A1
• UniProt Synonym Gene Names: ACATN; AT1; AT-1
• UniProt Entry Name: ACATN_HUMAN

NCBI Description

The protein encoded by this gene is required for the formation of O-acetylated (Ac) gangliosides. The encoded protein is predicted to contain 6 to 10 transmembrane domains, and a leucine zipper motif in transmembrane domain III. Defects in this gene have been reported to cause spastic paraplegia autosomal dominant type 42 (SPG42) in one Chinese family, but not in similar patients of European descent. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2010]

Uniprot Description

SLC33A1: Probable acetyl-CoA transporter necessary for O- acetylation of gangliosides. Defects in SLC33A1 are the cause of spastic paraplegia autosomal dominant type 42 (SPG42). Spastic paraplegia is a neurodegenerative disorder characterized by a slow, gradual, progressive weakness and spasticity of the lower limbs. Rate of progression and the severity of symptoms are quite variable. Initial symptoms may include difficulty with balance, weakness and stiffness in the legs, muscle spasms, and dragging the toes when walking. In some forms of the disorder, bladder symptoms (such as incontinence) may appear, or the weakness and stiffness may spread to other parts of the body. Defects in SLC33A1 are the cause of congenital cataracts, hearing loss, and neurodegeneration (CCHLND). CCHLND is an autosomal recessive disorder characterized by congenital cataracts, severe psychomotor retardation, and hearing loss associated with decreased serum ceruloplasmin and copper. Brain MRI shows cerebral and cerebellar atrophy and hypomyelination. Belongs to the SLC33A transporter family.

Protein type: Membrane protein, integral; Transporter; Transporter, SLC family; Glycan Metabolism - glycosphingolipid biosynthesis - ganglio series; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 3q25.31

Cellular Component: Golgi membrane; endoplasmic reticulum membrane; membrane; integral to plasma membrane

Molecular Function: acetyl-CoA transporter activity; solute:hydrogen symporter activity

Biological Process: proton transport; acetyl-CoA transport; transport; transmembrane transport

Disease: Spastic Paraplegia 42, Autosomal Dominant; Congenital Cataracts, Hearing Loss, And Neurodegeneration