Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-SLC2A8 Polyclonal Antibody)

Rabbit anti-Mouse, Rat SLC2A8 Polyclonal Antibody | anti-SLC2A8 antibody

SLC2A8 Polyclonal Antibody

Gene Names
SLC2A8; GLUT8; GLUTX1
Reactivity
Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
SLC2A8; Polyclonal Antibody; SLC2A8 Polyclonal Antibody; GLUT8; GLUTX1; solute carrier family 2 member 8; anti-SLC2A8 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
2.37 mg/ml (varies by lot)
Sequence Length
477
Applicable Applications for anti-SLC2A8 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 200-260 of human SLC2A8 (NP_055395.2).
Immunogen Sequence
CFMPETPRFLLTQHRRQEAMAALRFLWGSEQGWEDPPIGAEQSFHLALLRQPGIYKPFIIG
Positive Samples
Mouse Testis, Mouse Brain, Mouse Heart, Rat Testis
Cellular Location
Cell Membrane, Cytoplasmic Vesicle Membrane, Multi-Pass Membrane Protein
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-SLC2A8 Polyclonal Antibody)

Western Blot (WB) (Western blot-SLC2A8 Polyclonal Antibody)
Related Product Information for anti-SLC2A8 antibody
This gene belongs to the solute carrier 2A family, which includes intracellular glucose transporters. Based on sequence comparison, the glucose transporters are grouped into three classes and this gene is a member of class II. The encoded protein, like other members of the family, contains several conserved residues and motifs and 12 transmembrane domains with both amino and carboxyl ends being on the cytosolic side of the membrane. Alternatively spliced transcript variants have been described for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
Calculated: 50kDa
Observed: 51kDa
NCBI Official Full Name
glucose transporter 8
NCBI Official Synonym Full Names
solute carrier family 2 member 8
NCBI Official Symbol
SLC2A8
NCBI Official Synonym Symbols
GLUT8; GLUTX1
NCBI Protein Information
solute carrier family 2, facilitated glucose transporter member 8
UniProt Protein Name
Solute carrier family 2, facilitated glucose transporter member 8
Protein Family
UniProt Gene Name
SLC2A8
UniProt Synonym Gene Names
GLUT8; GLUTX1; GLUT-8

NCBI Description

This gene belongs to the solute carrier 2A family, which includes intracellular glucose transporters. Based on sequence comparison, the glucose transporters are grouped into three classes and this gene is a member of class II. The encoded protein, like other members of the family, contains several conserved residues and motifs and 12 transmembrane domains with both amino and carboxyl ends being on the cytosolic side of the membrane. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Nov 2012]

Uniprot Description

Insulin-regulated facilitative glucose transporter. Binds cytochalasin B in a glucose-inhibitable manner. Seems to be a dual-specific sugar transporter as it is inhibitable by fructose ().

Research Articles on SLC2A8

Similar Products

Product Notes

The SLC2A8 slc2a8 (Catalog #AAA9140895) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC2A8 Polyclonal Antibody reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SLC2A8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the SLC2A8 slc2a8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC2A8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.